Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IM712_RS12190 Genome accession   NZ_CP063768
Coordinates   2396255..2396428 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain KMU01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2391255..2401428
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IM712_RS12140 comGD 2391376..2391813 (+) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene
  IM712_RS12145 comGE 2391797..2392111 (+) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  IM712_RS12150 comGF 2392125..2392520 (+) 396 WP_077722593.1 competence type IV pilus minor pilin ComGF -
  IM712_RS12155 comGG 2392521..2392898 (+) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  IM712_RS12160 - 2392955..2393134 (+) 180 WP_003153093.1 YqzE family protein -
  IM712_RS12165 - 2393174..2393503 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  IM712_RS12170 tapA 2393762..2394433 (+) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  IM712_RS12175 sipW 2394405..2394989 (+) 585 WP_012117977.1 signal peptidase I SipW -
  IM712_RS12180 tasA 2395053..2395838 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  IM712_RS12185 sinR 2395886..2396221 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IM712_RS12190 sinI 2396255..2396428 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  IM712_RS12195 - 2396605..2397399 (-) 795 WP_014305407.1 YqhG family protein -
  IM712_RS12200 - 2397417..2399087 (-) 1671 WP_194298537.1 DEAD/DEAH box helicase -
  IM712_RS12205 gcvT 2399511..2400611 (+) 1101 WP_077722591.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=496616 IM712_RS12190 WP_003153105.1 2396255..2396428(-) (sinI) [Bacillus velezensis strain KMU01]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=496616 IM712_RS12190 WP_003153105.1 2396255..2396428(-) (sinI) [Bacillus velezensis strain KMU01]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702