Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   IM712_RS12145 Genome accession   NZ_CP063768
Coordinates   2391797..2392111 (+) Length   104 a.a.
NCBI ID   WP_077722594.1    Uniprot ID   -
Organism   Bacillus velezensis strain KMU01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2386797..2397111
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IM712_RS12120 - 2387839..2388789 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  IM712_RS12125 comGA 2388980..2390049 (+) 1070 Protein_2342 competence type IV pilus ATPase ComGA -
  IM712_RS12130 comGB 2390036..2391073 (+) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  IM712_RS12135 comGC 2391120..2391386 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  IM712_RS12140 comGD 2391376..2391813 (+) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene
  IM712_RS12145 comGE 2391797..2392111 (+) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  IM712_RS12150 comGF 2392125..2392520 (+) 396 WP_077722593.1 competence type IV pilus minor pilin ComGF -
  IM712_RS12155 comGG 2392521..2392898 (+) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  IM712_RS12160 - 2392955..2393134 (+) 180 WP_003153093.1 YqzE family protein -
  IM712_RS12165 - 2393174..2393503 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  IM712_RS12170 tapA 2393762..2394433 (+) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  IM712_RS12175 sipW 2394405..2394989 (+) 585 WP_012117977.1 signal peptidase I SipW -
  IM712_RS12180 tasA 2395053..2395838 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  IM712_RS12185 sinR 2395886..2396221 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IM712_RS12190 sinI 2396255..2396428 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11860.84 Da        Isoelectric Point: 6.9470

>NTDB_id=496613 IM712_RS12145 WP_077722594.1 2391797..2392111(+) (comGE) [Bacillus velezensis strain KMU01]
MLNGNKGFSTIETLSAMSIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=496613 IM712_RS12145 WP_077722594.1 2391797..2392111(+) (comGE) [Bacillus velezensis strain KMU01]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGTCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49