Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IM712_RS09185 Genome accession   NZ_CP063768
Coordinates   1835934..1836074 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain KMU01     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1830934..1841074
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IM712_RS09160 - 1831241..1831639 (+) 399 WP_003152031.1 YueI family protein -
  IM712_RS09165 - 1831736..1832287 (+) 552 WP_077722769.1 cysteine hydrolase family protein -
  IM712_RS09170 - 1832305..1833771 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  IM712_RS09175 - 1833901..1835121 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  IM712_RS09180 - 1835128..1835469 (-) 342 WP_014305721.1 hypothetical protein -
  IM712_RS09185 degQ 1835934..1836074 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  IM712_RS09190 - 1836226..1837137 (+) 912 WP_031378407.1 polyprenyl synthetase family protein -
  IM712_RS09195 comX 1837137..1837301 (+) 165 WP_007613432.1 competence pheromone ComX -
  IM712_RS09200 comP 1837313..1839604 (+) 2292 WP_077722768.1 histidine kinase Regulator
  IM712_RS09205 comA 1839685..1840329 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  IM712_RS09210 - 1840351..1840734 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=496595 IM712_RS09185 WP_003152043.1 1835934..1836074(+) (degQ) [Bacillus velezensis strain KMU01]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=496595 IM712_RS09185 WP_003152043.1 1835934..1836074(+) (degQ) [Bacillus velezensis strain KMU01]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891