Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   L897_RS00670 Genome accession   NC_021807
Coordinates   105857..106141 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes HSC5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 100857..111141
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L897_RS00645 (L897_00670) - 102803..103168 (+) 366 WP_002986560.1 DUF1033 family protein -
  L897_RS00650 (L897_00675) comGA 103261..104199 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  L897_RS00655 (L897_00680) comGB 104135..105169 (+) 1035 WP_236608388.1 competence type IV pilus assembly protein ComGB Machinery gene
  L897_RS00660 (L897_00685) comGC 105171..105497 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  L897_RS00665 (L897_00690) comGD 105472..105900 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  L897_RS00670 (L897_00695) comGE 105857..106141 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  L897_RS00675 (L897_00700) comGF 106134..106568 (+) 435 WP_020833199.1 competence type IV pilus minor pilin ComGF Machinery gene
  L897_RS00680 (L897_00705) comGG 106552..106878 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  L897_RS00685 (L897_00710) comGH 106976..107929 (+) 954 WP_042361463.1 class I SAM-dependent methyltransferase Machinery gene
  L897_RS00690 (L897_00715) - 107988..109184 (+) 1197 WP_020833201.1 acetate kinase -
  L897_RS09080 (L897_00720) - 109371..109679 (+) 309 Protein_92 hypothetical protein -
  L897_RS00695 (L897_00725) proC 109762..110532 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=49640 L897_RS00670 WP_011284422.1 105857..106141(+) (comGE) [Streptococcus pyogenes HSC5]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=49640 L897_RS00670 WP_011284422.1 105857..106141(+) (comGE) [Streptococcus pyogenes HSC5]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment