Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BACVE_RS13025 Genome accession   NZ_CP063687
Coordinates   2587863..2588003 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain NST6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2582863..2593003
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BACVE_RS13000 (BACVE_002625) - 2583167..2583565 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  BACVE_RS13005 (BACVE_002626) - 2583662..2584213 (+) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  BACVE_RS13010 (BACVE_002627) - 2584231..2585697 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BACVE_RS13015 (BACVE_002628) - 2585827..2587050 (+) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  BACVE_RS13020 (BACVE_002629) - 2587057..2587398 (-) 342 WP_014418765.1 hypothetical protein -
  BACVE_RS13025 (BACVE_002630) degQ 2587863..2588003 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BACVE_RS13030 (BACVE_002631) comQ 2588134..2589120 (+) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  BACVE_RS13035 (BACVE_002632) comX 2589083..2589253 (+) 171 WP_025650218.1 competence pheromone ComX Regulator
  BACVE_RS13040 (BACVE_002633) comP 2589273..2591576 (+) 2304 WP_025650219.1 histidine kinase Regulator
  BACVE_RS13045 (BACVE_002634) comA 2591657..2592301 (+) 645 WP_071181952.1 response regulator transcription factor Regulator
  BACVE_RS13050 (BACVE_002635) - 2592323..2592706 (+) 384 WP_065180456.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=496289 BACVE_RS13025 WP_003152043.1 2587863..2588003(+) (degQ) [Bacillus velezensis strain NST6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=496289 BACVE_RS13025 WP_003152043.1 2587863..2588003(+) (degQ) [Bacillus velezensis strain NST6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891