Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IMY14_RS16970 Genome accession   NZ_CP063150
Coordinates   3237208..3237348 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain s-16     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3232208..3242348
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IMY14_RS16945 yuxO 3232551..3232931 (-) 381 WP_174616601.1 hotdog fold thioesterase -
  IMY14_RS16950 comA 3232949..3233593 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IMY14_RS16955 - 3233674..3235974 (-) 2301 Protein_3312 histidine kinase -
  IMY14_RS16960 comX 3235986..3236150 (-) 165 WP_015384519.1 competence pheromone ComX -
  IMY14_RS16965 - 3236163..3237023 (-) 861 WP_015483633.1 polyprenyl synthetase family protein -
  IMY14_RS16970 degQ 3237208..3237348 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IMY14_RS16975 - 3237570..3237695 (+) 126 WP_154796978.1 hypothetical protein -
  IMY14_RS16980 - 3237809..3238177 (+) 369 WP_015483634.1 hypothetical protein -
  IMY14_RS16985 pdeH 3238153..3239382 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IMY14_RS16990 pncB 3239519..3240991 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  IMY14_RS16995 pncA 3241007..3241558 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  IMY14_RS17000 yueI 3241655..3242053 (-) 399 WP_014477837.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=493421 IMY14_RS16970 WP_003220708.1 3237208..3237348(-) (degQ) [Bacillus subtilis strain s-16]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=493421 IMY14_RS16970 WP_003220708.1 3237208..3237348(-) (degQ) [Bacillus subtilis strain s-16]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1