Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KHA81_RS15140 Genome accession   NZ_CP074391
Coordinates   3078982..3079122 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain L-17     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3073982..3084122
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHA81_RS15115 - 3074322..3074705 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  KHA81_RS15120 comA 3074727..3075371 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  KHA81_RS15125 comP 3075452..3077743 (-) 2292 WP_015387784.1 histidine kinase Regulator
  KHA81_RS15130 comX 3077755..3077919 (-) 165 WP_007613432.1 competence pheromone ComX -
  KHA81_RS15135 comQ 3077919..3078797 (-) 879 WP_024085740.1 polyprenyl synthetase family protein Regulator
  KHA81_RS15140 degQ 3078982..3079122 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  KHA81_RS15145 - 3079588..3079929 (+) 342 WP_014305721.1 hypothetical protein -
  KHA81_RS15150 - 3079936..3081156 (-) 1221 WP_015387782.1 EAL and HDOD domain-containing protein -
  KHA81_RS15155 - 3081286..3082752 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  KHA81_RS15160 - 3082770..3083321 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  KHA81_RS15165 - 3083418..3083816 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=491241 KHA81_RS15140 WP_003152043.1 3078982..3079122(-) (degQ) [Bacillus amyloliquefaciens strain L-17]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=491241 KHA81_RS15140 WP_003152043.1 3078982..3079122(-) (degQ) [Bacillus amyloliquefaciens strain L-17]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891