Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | KHA81_RS15140 | Genome accession | NZ_CP074391 |
| Coordinates | 3078982..3079122 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain L-17 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3073982..3084122
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KHA81_RS15115 | - | 3074322..3074705 (-) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
| KHA81_RS15120 | comA | 3074727..3075371 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| KHA81_RS15125 | comP | 3075452..3077743 (-) | 2292 | WP_015387784.1 | histidine kinase | Regulator |
| KHA81_RS15130 | comX | 3077755..3077919 (-) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| KHA81_RS15135 | comQ | 3077919..3078797 (-) | 879 | WP_024085740.1 | polyprenyl synthetase family protein | Regulator |
| KHA81_RS15140 | degQ | 3078982..3079122 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| KHA81_RS15145 | - | 3079588..3079929 (+) | 342 | WP_014305721.1 | hypothetical protein | - |
| KHA81_RS15150 | - | 3079936..3081156 (-) | 1221 | WP_015387782.1 | EAL and HDOD domain-containing protein | - |
| KHA81_RS15155 | - | 3081286..3082752 (-) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| KHA81_RS15160 | - | 3082770..3083321 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| KHA81_RS15165 | - | 3083418..3083816 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=491241 KHA81_RS15140 WP_003152043.1 3078982..3079122(-) (degQ) [Bacillus amyloliquefaciens strain L-17]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=491241 KHA81_RS15140 WP_003152043.1 3078982..3079122(-) (degQ) [Bacillus amyloliquefaciens strain L-17]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |