Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   KEF49_RS01965 Genome accession   NZ_CP073635
Coordinates   422118..422237 (+) Length   39 a.a.
NCBI ID   WP_013351005.1    Uniprot ID   A0A150F3U5
Organism   Bacillus amyloliquefaciens strain Ba13     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 417118..427237
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KEF49_RS01950 (KEF49_01950) - 418729..419412 (+) 684 WP_013351002.1 response regulator transcription factor -
  KEF49_RS01955 (KEF49_01955) - 419399..420826 (+) 1428 WP_212100309.1 HAMP domain-containing sensor histidine kinase -
  KEF49_RS01960 (KEF49_01960) rapC 420986..422134 (+) 1149 WP_065980700.1 tetratricopeptide repeat protein Regulator
  KEF49_RS01965 (KEF49_01965) phrC 422118..422237 (+) 120 WP_013351005.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  KEF49_RS01970 (KEF49_01970) - 422385..422495 (-) 111 WP_065980701.1 YjcZ family sporulation protein -
  KEF49_RS01975 (KEF49_01975) - 422590..423954 (-) 1365 WP_065980702.1 aspartate kinase -
  KEF49_RS01980 (KEF49_01980) ceuB 424369..425322 (+) 954 WP_013351008.1 ABC transporter permease Machinery gene
  KEF49_RS01985 (KEF49_01985) - 425312..426259 (+) 948 WP_065980704.1 iron chelate uptake ABC transporter family permease subunit -
  KEF49_RS01990 (KEF49_01990) - 426253..427011 (+) 759 WP_065980705.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=487575 KEF49_RS01965 WP_013351005.1 422118..422237(+) (phrC) [Bacillus amyloliquefaciens strain Ba13]
MKLKSKWFVICLAAAAIFTAAGVSQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=487575 KEF49_RS01965 WP_013351005.1 422118..422237(+) (phrC) [Bacillus amyloliquefaciens strain Ba13]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGCTGCAGGTGTAAGCCAGACAGA
TCAGGCTGAATTCCATGTGGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A150F3U5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

80

100

0.821