Detailed information
Overview
| Name | comM | Type | Machinery gene |
| Locus tag | KCG51_RS00060 | Genome accession | NZ_CP073119 |
| Coordinates | 6344..6508 (+) | Length | 54 a.a. |
| NCBI ID | WP_254342571.1 | Uniprot ID | - |
| Organism | Neisseria subflava strain HP0069 | ||
| Function | promote branch migration; interact with DprA; integration of tDNA (predicted from homology) Homologous recombination |
||
Genomic Context
Location: 1344..11508
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KCG51_RS00020 | - | 3582..3815 (+) | 234 | WP_254342563.1 | S-adenosylmethionine synthetase N-terminal domain-containing protein | - |
| KCG51_RS00025 | - | 3812..4096 (+) | 285 | WP_254342565.1 | hypothetical protein | - |
| KCG51_RS00030 | - | 4142..4468 (+) | 327 | WP_254342566.1 | methionine adenosyltransferase domain-containing protein | - |
| KCG51_RS00035 | - | 4474..4656 (+) | 183 | WP_254342568.1 | hypothetical protein | - |
| KCG51_RS00040 (KCG51_00025) | - | 4751..5072 (+) | 322 | Protein_7 | accessory factor UbiK family protein | - |
| KCG51_RS00045 | comM | 5076..5552 (+) | 477 | WP_254342569.1 | magnesium chelatase domain-containing protein | Machinery gene |
| KCG51_RS00050 | - | 5879..6031 (-) | 153 | WP_254342570.1 | hypothetical protein | - |
| KCG51_RS00055 | - | 6032..6408 (+) | 377 | Protein_10 | ATP-binding protein | - |
| KCG51_RS00060 | comM | 6344..6508 (+) | 165 | WP_254342571.1 | hypothetical protein | Machinery gene |
| KCG51_RS00065 (KCG51_00035) | - | 6690..6811 (+) | 122 | Protein_12 | cell division protein FtsN | - |
| KCG51_RS00070 (KCG51_00040) | - | 6960..7421 (-) | 462 | WP_254342572.1 | hypothetical protein | - |
| KCG51_RS10790 | - | 7844..8437 (+) | 594 | Protein_14 | thiol:disulfide interchange protein DsbA/DsbL | - |
| KCG51_RS00075 (KCG51_00045) | - | 8482..9299 (+) | 818 | Protein_15 | undecaprenyl-diphosphate phosphatase | - |
| KCG51_RS00080 (KCG51_00050) | - | 9369..9818 (-) | 450 | Protein_16 | type IV pilin protein | - |
| KCG51_RS00090 (KCG51_00055) | - | 10034..10317 (-) | 284 | Protein_17 | helix-hairpin-helix domain-containing protein | - |
Sequence
Protein
Download Length: 54 a.a. Molecular weight: 6107.05 Da Isoelectric Point: 10.4637
>NTDB_id=487028 KCG51_RS00060 WP_254342571.1 6344..6508(+) (comM) [Neisseria subflava strain HP0069]
MRARWQSPHPKEAQEALGTMLEKLSLSARSFHRIMRVARTLADLAGDEESAKPM
MRARWQSPHPKEAQEALGTMLEKLSLSARSFHRIMRVARTLADLAGDEESAKPM
Nucleotide
Download Length: 165 bp
>NTDB_id=487028 KCG51_RS00060 WP_254342571.1 6344..6508(+) (comM) [Neisseria subflava strain HP0069]
GTGCGAGCTCGATGGCAAAGCCCGCATCCAAAAGAAGCGCAAGAAGCCTTGGGAACCATGCTTGAAAAACTGTCCCTTTC
CGCACGAAGTTTCCACCGCATCATGCGCGTCGCCCGTACGCTGGCCGATTTGGCAGGCGACGAAGAGTCAGCAAAACCCA
TGTGA
GTGCGAGCTCGATGGCAAAGCCCGCATCCAAAAGAAGCGCAAGAAGCCTTGGGAACCATGCTTGAAAAACTGTCCCTTTC
CGCACGAAGTTTCCACCGCATCATGCGCGTCGCCCGTACGCTGGCCGATTTGGCAGGCGACGAAGAGTCAGCAAAACCCA
TGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comM | Vibrio cholerae O1 biovar El Tor strain E7946 |
46.809 |
87.037 |
0.407 |
| comM | Vibrio cholerae strain A1552 |
46.809 |
87.037 |
0.407 |
| comM | Vibrio campbellii strain DS40M4 |
50 |
74.074 |
0.37 |