Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   IEN91_RS12940 Genome accession   NZ_CP061938
Coordinates   2650596..2650973 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain FIO1408     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2645596..2655973
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IEN91_RS12900 (IEN91_12900) - 2646095..2646889 (+) 795 WP_196616035.1 YqhG family protein -
  IEN91_RS12905 (IEN91_12905) sinI 2647066..2647239 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  IEN91_RS12910 (IEN91_12910) sinR 2647273..2647608 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IEN91_RS12915 (IEN91_12915) tasA 2647656..2648441 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  IEN91_RS12920 (IEN91_12920) sipW 2648505..2649089 (-) 585 WP_012117977.1 signal peptidase I SipW -
  IEN91_RS12925 (IEN91_12925) tapA 2649061..2649732 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  IEN91_RS12930 (IEN91_12930) - 2649991..2650320 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  IEN91_RS12935 (IEN91_12935) - 2650360..2650539 (-) 180 WP_003153093.1 YqzE family protein -
  IEN91_RS12940 (IEN91_12940) comGG 2650596..2650973 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  IEN91_RS12945 (IEN91_12945) comGF 2650974..2651474 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  IEN91_RS12950 (IEN91_12950) comGE 2651383..2651697 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  IEN91_RS12955 (IEN91_12955) comGD 2651681..2652118 (-) 438 WP_072588444.1 competence type IV pilus minor pilin ComGD Machinery gene
  IEN91_RS12960 (IEN91_12960) comGC 2652108..2652416 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  IEN91_RS12965 (IEN91_12965) comGB 2652421..2653458 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  IEN91_RS12970 (IEN91_12970) comGA 2653445..2654515 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  IEN91_RS12975 (IEN91_12975) - 2654707..2655657 (-) 951 WP_196616036.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=485595 IEN91_RS12940 WP_014305410.1 2650596..2650973(-) (comGG) [Bacillus velezensis strain FIO1408]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=485595 IEN91_RS12940 WP_014305410.1 2650596..2650973(-) (comGG) [Bacillus velezensis strain FIO1408]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512