Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | IEN91_RS12905 | Genome accession | NZ_CP061938 |
| Coordinates | 2647066..2647239 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain FIO1408 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2642066..2652239
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IEN91_RS12890 (IEN91_12890) | gcvT | 2642884..2643984 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| IEN91_RS12895 (IEN91_12895) | - | 2644407..2646077 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| IEN91_RS12900 (IEN91_12900) | - | 2646095..2646889 (+) | 795 | WP_196616035.1 | YqhG family protein | - |
| IEN91_RS12905 (IEN91_12905) | sinI | 2647066..2647239 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| IEN91_RS12910 (IEN91_12910) | sinR | 2647273..2647608 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| IEN91_RS12915 (IEN91_12915) | tasA | 2647656..2648441 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| IEN91_RS12920 (IEN91_12920) | sipW | 2648505..2649089 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| IEN91_RS12925 (IEN91_12925) | tapA | 2649061..2649732 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| IEN91_RS12930 (IEN91_12930) | - | 2649991..2650320 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| IEN91_RS12935 (IEN91_12935) | - | 2650360..2650539 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| IEN91_RS12940 (IEN91_12940) | comGG | 2650596..2650973 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| IEN91_RS12945 (IEN91_12945) | comGF | 2650974..2651474 (-) | 501 | WP_226565836.1 | competence type IV pilus minor pilin ComGF | - |
| IEN91_RS12950 (IEN91_12950) | comGE | 2651383..2651697 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| IEN91_RS12955 (IEN91_12955) | comGD | 2651681..2652118 (-) | 438 | WP_072588444.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=485593 IEN91_RS12905 WP_003153105.1 2647066..2647239(+) (sinI) [Bacillus velezensis strain FIO1408]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=485593 IEN91_RS12905 WP_003153105.1 2647066..2647239(+) (sinI) [Bacillus velezensis strain FIO1408]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |