Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IEN91_RS12905 Genome accession   NZ_CP061938
Coordinates   2647066..2647239 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain FIO1408     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2642066..2652239
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IEN91_RS12890 (IEN91_12890) gcvT 2642884..2643984 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  IEN91_RS12895 (IEN91_12895) - 2644407..2646077 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  IEN91_RS12900 (IEN91_12900) - 2646095..2646889 (+) 795 WP_196616035.1 YqhG family protein -
  IEN91_RS12905 (IEN91_12905) sinI 2647066..2647239 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  IEN91_RS12910 (IEN91_12910) sinR 2647273..2647608 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IEN91_RS12915 (IEN91_12915) tasA 2647656..2648441 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  IEN91_RS12920 (IEN91_12920) sipW 2648505..2649089 (-) 585 WP_012117977.1 signal peptidase I SipW -
  IEN91_RS12925 (IEN91_12925) tapA 2649061..2649732 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  IEN91_RS12930 (IEN91_12930) - 2649991..2650320 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  IEN91_RS12935 (IEN91_12935) - 2650360..2650539 (-) 180 WP_003153093.1 YqzE family protein -
  IEN91_RS12940 (IEN91_12940) comGG 2650596..2650973 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  IEN91_RS12945 (IEN91_12945) comGF 2650974..2651474 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  IEN91_RS12950 (IEN91_12950) comGE 2651383..2651697 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  IEN91_RS12955 (IEN91_12955) comGD 2651681..2652118 (-) 438 WP_072588444.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=485593 IEN91_RS12905 WP_003153105.1 2647066..2647239(+) (sinI) [Bacillus velezensis strain FIO1408]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=485593 IEN91_RS12905 WP_003153105.1 2647066..2647239(+) (sinI) [Bacillus velezensis strain FIO1408]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702