Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IE382_RS19355 Genome accession   NZ_CP061870
Coordinates   3565606..3565746 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain FX-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3560606..3570746
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IE382_RS19330 (IE382_19230) yuxO 3560883..3561263 (-) 381 WP_041052848.1 hotdog fold thioesterase -
  IE382_RS19335 (IE382_19235) comA 3561282..3561926 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IE382_RS19340 (IE382_19240) comP 3562007..3564319 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  IE382_RS19345 (IE382_19245) comX 3564335..3564556 (-) 222 WP_014480704.1 competence pheromone ComX -
  IE382_RS19350 (IE382_19250) - 3564558..3565421 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  IE382_RS19355 (IE382_19255) degQ 3565606..3565746 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IE382_RS19360 (IE382_19260) - 3565968..3566093 (+) 126 WP_003228793.1 hypothetical protein -
  IE382_RS19365 (IE382_19265) - 3566207..3566575 (+) 369 WP_014477834.1 hypothetical protein -
  IE382_RS19370 (IE382_19270) pdeH 3566551..3567780 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IE382_RS19375 (IE382_19275) pncB 3567917..3569389 (-) 1473 WP_041352162.1 nicotinate phosphoribosyltransferase -
  IE382_RS19380 (IE382_19280) pncA 3569405..3569956 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  IE382_RS19385 (IE382_19285) yueI 3570053..3570451 (-) 399 WP_017695530.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=485465 IE382_RS19355 WP_003220708.1 3565606..3565746(-) (degQ) [Bacillus subtilis strain FX-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=485465 IE382_RS19355 WP_003220708.1 3565606..3565746(-) (degQ) [Bacillus subtilis strain FX-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1