Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BAMOH1_RS14630 Genome accession   NZ_CP061853
Coordinates   3018346..3018486 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain MOH1-5b     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3013346..3023486
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMOH1_RS14605 (BAMOH1_14605) - 3013665..3014048 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  BAMOH1_RS14610 (BAMOH1_14610) comA 3014070..3014714 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  BAMOH1_RS14615 (BAMOH1_14615) comP 3014795..3017101 (-) 2307 WP_191389162.1 sensor histidine kinase Regulator
  BAMOH1_RS14620 (BAMOH1_14620) comX 3017124..3017300 (-) 177 WP_095273329.1 competence pheromone ComX -
  BAMOH1_RS14625 (BAMOH1_14625) - 3017319..3018194 (-) 876 WP_095273351.1 polyprenyl synthetase family protein -
  BAMOH1_RS14630 (BAMOH1_14630) degQ 3018346..3018486 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BAMOH1_RS14635 (BAMOH1_14635) - 3018951..3019292 (+) 342 WP_021495366.1 hypothetical protein -
  BAMOH1_RS14640 (BAMOH1_14640) - 3019299..3020522 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  BAMOH1_RS14645 (BAMOH1_14645) - 3020652..3022118 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BAMOH1_RS14650 (BAMOH1_14650) - 3022136..3022687 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  BAMOH1_RS14655 (BAMOH1_14655) - 3022784..3023182 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=485309 BAMOH1_RS14630 WP_003152043.1 3018346..3018486(-) (degQ) [Bacillus amyloliquefaciens strain MOH1-5b]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=485309 BAMOH1_RS14630 WP_003152043.1 3018346..3018486(-) (degQ) [Bacillus amyloliquefaciens strain MOH1-5b]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891