Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BAINH2_RS11575 Genome accession   NZ_CP061852
Coordinates   2454520..2454693 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain INH2-4b     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2449520..2459693
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAINH2_RS11560 (BAINH2_11560) gcvT 2450333..2451433 (-) 1101 WP_053573200.1 glycine cleavage system aminomethyltransferase GcvT -
  BAINH2_RS11565 (BAINH2_11565) - 2451857..2453527 (+) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  BAINH2_RS11570 (BAINH2_11570) - 2453549..2454343 (+) 795 WP_007408330.1 YqhG family protein -
  BAINH2_RS11575 (BAINH2_11575) sinI 2454520..2454693 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  BAINH2_RS11580 (BAINH2_11580) sinR 2454727..2455062 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAINH2_RS11585 (BAINH2_11585) tasA 2455110..2455895 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAINH2_RS11590 (BAINH2_11590) sipW 2455960..2456544 (-) 585 WP_015240205.1 signal peptidase I SipW -
  BAINH2_RS11595 (BAINH2_11595) tapA 2456516..2457187 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  BAINH2_RS11600 (BAINH2_11600) - 2457446..2457775 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  BAINH2_RS11605 (BAINH2_11605) - 2457815..2457994 (-) 180 WP_003153093.1 YqzE family protein -
  BAINH2_RS11610 (BAINH2_11610) comGG 2458051..2458428 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAINH2_RS11615 (BAINH2_11615) comGF 2458429..2458929 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  BAINH2_RS11620 (BAINH2_11620) comGE 2458838..2459152 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  BAINH2_RS11625 (BAINH2_11625) comGD 2459136..2459573 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=485210 BAINH2_RS11575 WP_003153105.1 2454520..2454693(+) (sinI) [Bacillus amyloliquefaciens strain INH2-4b]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=485210 BAINH2_RS11575 WP_003153105.1 2454520..2454693(+) (sinI) [Bacillus amyloliquefaciens strain INH2-4b]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702