Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IAU66_RS15350 Genome accession   NZ_CP061168
Coordinates   3138193..3138333 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain T-5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3133193..3143333
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IAU66_RS15325 - 3133533..3133916 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  IAU66_RS15330 comA 3133938..3134582 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  IAU66_RS15335 comP 3134663..3136954 (-) 2292 WP_014305719.1 histidine kinase Regulator
  IAU66_RS15340 comX 3136966..3137130 (-) 165 WP_007613432.1 competence pheromone ComX -
  IAU66_RS15345 - 3137130..3138041 (-) 912 WP_014305720.1 polyprenyl synthetase family protein -
  IAU66_RS15350 degQ 3138193..3138333 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  IAU66_RS15355 - 3138799..3139140 (+) 342 WP_014305721.1 hypothetical protein -
  IAU66_RS15360 - 3139147..3140367 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  IAU66_RS15365 - 3140497..3141963 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  IAU66_RS15370 - 3141981..3142532 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  IAU66_RS15375 - 3142629..3143027 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=481095 IAU66_RS15350 WP_003152043.1 3138193..3138333(-) (degQ) [Bacillus amyloliquefaciens strain T-5]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=481095 IAU66_RS15350 WP_003152043.1 3138193..3138333(-) (degQ) [Bacillus amyloliquefaciens strain T-5]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891