Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   J5X95_RS01575 Genome accession   NZ_CP072120
Coordinates   322537..322710 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain GKT04     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 317537..327710
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J5X95_RS01560 (J5X95_01560) gcvT 318350..319450 (-) 1101 WP_032866432.1 glycine cleavage system aminomethyltransferase GcvT -
  J5X95_RS01565 (J5X95_01565) - 319874..321544 (+) 1671 WP_124934996.1 DEAD/DEAH box helicase -
  J5X95_RS01570 (J5X95_01570) - 321566..322360 (+) 795 WP_076424968.1 YqhG family protein -
  J5X95_RS01575 (J5X95_01575) sinI 322537..322710 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  J5X95_RS01580 (J5X95_01580) sinR 322744..323079 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J5X95_RS01585 (J5X95_01585) tasA 323127..323912 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  J5X95_RS01590 (J5X95_01590) sipW 323977..324561 (-) 585 WP_015240205.1 signal peptidase I SipW -
  J5X95_RS01595 (J5X95_01595) tapA 324533..325204 (-) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  J5X95_RS01600 (J5X95_01600) - 325463..325792 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  J5X95_RS01605 (J5X95_01605) - 325832..326011 (-) 180 WP_003153093.1 YqzE family protein -
  J5X95_RS01610 (J5X95_01610) comGG 326068..326445 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  J5X95_RS01615 (J5X95_01615) comGF 326446..326946 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  J5X95_RS01620 (J5X95_01620) comGE 326855..327169 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  J5X95_RS01625 (J5X95_01625) comGD 327153..327590 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=480689 J5X95_RS01575 WP_003153105.1 322537..322710(+) (sinI) [Bacillus amyloliquefaciens strain GKT04]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=480689 J5X95_RS01575 WP_003153105.1 322537..322710(+) (sinI) [Bacillus amyloliquefaciens strain GKT04]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702