Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IAR44_RS15130 Genome accession   NZ_CP061087
Coordinates   3117603..3117743 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CLA178     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3112603..3122743
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IAR44_RS15105 (IAR44_15105) - 3112917..3113300 (-) 384 WP_061860832.1 hotdog fold thioesterase -
  IAR44_RS15110 (IAR44_15110) comA 3113322..3113966 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  IAR44_RS15115 (IAR44_15115) comP 3114047..3116398 (-) 2352 WP_015418104.1 sensor histidine kinase Regulator
  IAR44_RS15120 (IAR44_15120) comX 3116376..3116546 (-) 171 WP_015418105.1 competence pheromone ComX -
  IAR44_RS15125 (IAR44_15125) - 3116543..3117472 (-) 930 WP_224462816.1 polyprenyl synthetase family protein -
  IAR44_RS15130 (IAR44_15130) degQ 3117603..3117743 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  IAR44_RS15135 (IAR44_15135) - 3118206..3118547 (+) 342 WP_015418107.1 hypothetical protein -
  IAR44_RS15140 (IAR44_15140) - 3118554..3119777 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  IAR44_RS15145 (IAR44_15145) - 3119907..3121373 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  IAR44_RS15150 (IAR44_15150) - 3121391..3121942 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  IAR44_RS15155 (IAR44_15155) - 3122039..3122437 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=480572 IAR44_RS15130 WP_003152043.1 3117603..3117743(-) (degQ) [Bacillus velezensis strain CLA178]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=480572 IAR44_RS15130 WP_003152043.1 3117603..3117743(-) (degQ) [Bacillus velezensis strain CLA178]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891