Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   SPN994038_RS02610 Genome accession   NC_021026
Coordinates   485617..485766 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   -
Organism   Streptococcus pneumoniae SPN994038     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 480617..490766
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPN994038_RS02585 (SPN994038_04790) blpC 480928..481083 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  SPN994038_RS02590 (SPN994038_04800) - 481140..482501 (-) 1362 WP_001069092.1 bacteriocin secretion accessory protein -
  SPN994038_RS13300 comA/nlmT 482512..483000 (-) 489 WP_307774349.1 ATP-binding cassette domain-containing protein Regulator
  SPN994038_RS13305 comA/nlmT 482984..483424 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  SPN994038_RS13310 comA/nlmT 483414..484139 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  SPN994038_RS13315 (SPN994038_04820) comA/nlmT 484084..484671 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  SPN994038_RS02605 (SPN994038_04830) blpI 484953..485150 (+) 198 WP_001093258.1 bacteriocin-like peptide BlpI -
  SPN994038_RS02610 cipB 485617..485766 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator
  SPN994038_RS02615 (SPN994038_04870) - 485870..485989 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  SPN994038_RS02625 (SPN994038_04900) - 486775..487158 (+) 384 WP_000877381.1 hypothetical protein -
  SPN994038_RS02630 (SPN994038_04910) - 487210..487899 (+) 690 WP_000760526.1 CPBP family intramembrane glutamic endopeptidase -
  SPN994038_RS02635 (SPN994038_04920) blpZ 487941..488189 (+) 249 WP_000276499.1 immunity protein BlpZ -
  SPN994038_RS02640 (SPN994038_04930) - 488219..488830 (+) 612 WP_000394047.1 CPBP family intramembrane glutamic endopeptidase -
  SPN994038_RS02645 (SPN994038_04940) ccrZ 488991..489785 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -
  SPN994038_RS02650 (SPN994038_04950) trmB 489782..490417 (+) 636 WP_001266080.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=48029 SPN994038_RS02610 WP_001808912.1 485617..485766(+) (cipB) [Streptococcus pneumoniae SPN994038]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=48029 SPN994038_RS02610 WP_001808912.1 485617..485766(+) (cipB) [Streptococcus pneumoniae SPN994038]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment