Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | SPN032672_RS08910 | Genome accession | NC_021003 |
| Coordinates | 1667548..1667697 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae SPN032672 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1662548..1672697
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPN032672_RS08850 | blpI | 1662583..1662780 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| SPN032672_RS08855 | blpJ | 1663247..1663516 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| SPN032672_RS08860 | blpU | 1663585..1663815 (+) | 231 | WP_000379964.1 | bacteriocin-like peptide BlpU | - |
| SPN032672_RS08865 | - | 1663818..1663937 (+) | 120 | WP_001844187.1 | PncF family bacteriocin immunity protein | - |
| SPN032672_RS12325 | - | 1664236..1664400 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| SPN032672_RS08875 | - | 1664397..1664792 (+) | 396 | WP_000846569.1 | hypothetical protein | - |
| SPN032672_RS12985 | - | 1664806..1665620 (-) | 815 | Protein_1665 | IS5-like element IS1515 family transposase | - |
| SPN032672_RS12330 | - | 1665877..1666681 (+) | 805 | WP_128887636.1 | IS5 family transposase | - |
| SPN032672_RS08900 | blpM | 1666831..1667085 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| SPN032672_RS08905 | blpN | 1667101..1667304 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| SPN032672_RS08910 | cipB | 1667548..1667697 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| SPN032672_RS08915 | - | 1667801..1667920 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| SPN032672_RS08925 | - | 1668706..1669090 (+) | 385 | Protein_1671 | immunity protein | - |
| SPN032672_RS08930 | - | 1669142..1669831 (+) | 690 | WP_000760515.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPN032672_RS08935 | blpZ | 1669873..1670121 (+) | 249 | WP_000276500.1 | immunity protein BlpZ | - |
| SPN032672_RS08940 | - | 1670151..1670762 (+) | 612 | WP_000394044.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPN032672_RS08945 | ccrZ | 1670923..1671717 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| SPN032672_RS08950 | trmB | 1671714..1672349 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=47750 SPN032672_RS08910 WP_001818346.1 1667548..1667697(+) (cipB) [Streptococcus pneumoniae SPN032672]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=47750 SPN032672_RS08910 WP_001818346.1 1667548..1667697(+) (cipB) [Streptococcus pneumoniae SPN032672]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |