Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   JWY36_RS16210 Genome accession   NZ_CP071276
Coordinates   3019374..3019514 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain JNFE0126     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3014374..3024514
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JWY36_RS16185 (JWY36_16040) yuxO 3014651..3015031 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  JWY36_RS16190 (JWY36_16045) comA 3015050..3015694 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  JWY36_RS16195 (JWY36_16050) comP 3015775..3018087 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  JWY36_RS16200 (JWY36_16055) comX 3018103..3018324 (-) 222 WP_014480704.1 competence pheromone ComX -
  JWY36_RS16205 (JWY36_16060) comQ 3018326..3019189 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  JWY36_RS16210 (JWY36_16065) degQ 3019374..3019514 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  JWY36_RS16215 (JWY36_16070) - 3019736..3019861 (+) 126 WP_003228793.1 hypothetical protein -
  JWY36_RS16220 (JWY36_16075) - 3019975..3020343 (+) 369 WP_014477834.1 hypothetical protein -
  JWY36_RS16225 (JWY36_16080) pdeH 3020319..3021548 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  JWY36_RS16230 (JWY36_16085) pncB 3021684..3023156 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  JWY36_RS16235 (JWY36_16090) pncA 3023172..3023723 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  JWY36_RS16240 (JWY36_16095) yueI 3023820..3024218 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=476608 JWY36_RS16210 WP_003220708.1 3019374..3019514(-) (degQ) [Bacillus subtilis strain JNFE0126]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=476608 JWY36_RS16210 WP_003220708.1 3019374..3019514(-) (degQ) [Bacillus subtilis strain JNFE0126]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1