Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   H8S71_RS15620 Genome accession   NZ_CP060417
Coordinates   3043377..3043517 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain ONU 559     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3038377..3048517
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H8S71_RS15595 (H8S71_15590) yuxO 3038653..3039033 (-) 381 WP_187002302.1 hotdog fold thioesterase -
  H8S71_RS15600 (H8S71_15595) comA 3039052..3039696 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  H8S71_RS15605 (H8S71_15600) comP 3039777..3042089 (-) 2313 WP_187001885.1 histidine kinase Regulator
  H8S71_RS15610 (H8S71_15605) comX 3042105..3042326 (-) 222 WP_014114983.1 competence pheromone ComX -
  H8S71_RS15615 (H8S71_15610) - 3042323..3043192 (-) 870 WP_169037713.1 polyprenyl synthetase family protein -
  H8S71_RS15620 (H8S71_15615) degQ 3043377..3043517 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  H8S71_RS20570 - 3043739..3043801 (+) 63 Protein_3033 hypothetical protein -
  H8S71_RS15625 (H8S71_15620) - 3043980..3044348 (+) 369 WP_017695529.1 hypothetical protein -
  H8S71_RS15630 (H8S71_15625) pdeH 3044324..3045553 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  H8S71_RS15635 (H8S71_15630) pncB 3045690..3047162 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  H8S71_RS15640 (H8S71_15635) pncA 3047178..3047729 (-) 552 WP_021480500.1 isochorismatase family cysteine hydrolase -
  H8S71_RS15645 (H8S71_15640) yueI 3047826..3048224 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=475915 H8S71_RS15620 WP_003220708.1 3043377..3043517(-) (degQ) [Bacillus subtilis subsp. subtilis strain ONU 559]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=475915 H8S71_RS15620 WP_003220708.1 3043377..3043517(-) (degQ) [Bacillus subtilis subsp. subtilis strain ONU 559]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1