Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   H8S71_RS12065 Genome accession   NZ_CP060417
Coordinates   2375958..2376131 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain ONU 559     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2370958..2381131
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H8S71_RS12050 (H8S71_12045) gcvT 2371758..2372846 (-) 1089 WP_187001803.1 glycine cleavage system aminomethyltransferase GcvT -
  H8S71_RS12055 (H8S71_12050) hepAA 2373287..2374960 (+) 1674 WP_128993149.1 SNF2-related protein -
  H8S71_RS12060 (H8S71_12055) yqhG 2374981..2375775 (+) 795 WP_003230200.1 YqhG family protein -
  H8S71_RS12065 (H8S71_12060) sinI 2375958..2376131 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  H8S71_RS12070 (H8S71_12065) sinR 2376165..2376500 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  H8S71_RS12075 (H8S71_12070) tasA 2376593..2377378 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  H8S71_RS12080 (H8S71_12075) sipW 2377442..2378014 (-) 573 WP_128993656.1 signal peptidase I SipW -
  H8S71_RS12085 (H8S71_12080) tapA 2377998..2378759 (-) 762 WP_128993152.1 amyloid fiber anchoring/assembly protein TapA -
  H8S71_RS12090 (H8S71_12085) yqzG 2379031..2379357 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  H8S71_RS12095 (H8S71_12090) spoIITA 2379399..2379578 (-) 180 WP_014480252.1 YqzE family protein -
  H8S71_RS12100 (H8S71_12095) comGG 2379650..2380024 (-) 375 WP_128993153.1 ComG operon protein ComGG Machinery gene
  H8S71_RS12105 (H8S71_12100) comGF 2380025..2380408 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  H8S71_RS12110 (H8S71_12105) comGE 2380434..2380781 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=475891 H8S71_RS12065 WP_003230187.1 2375958..2376131(+) (sinI) [Bacillus subtilis subsp. subtilis strain ONU 559]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=475891 H8S71_RS12065 WP_003230187.1 2375958..2376131(+) (sinI) [Bacillus subtilis subsp. subtilis strain ONU 559]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1