Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LRHM_RS05275 | Genome accession | NC_017482 |
| Coordinates | 1110646..1111131 (+) | Length | 161 a.a. |
| NCBI ID | WP_014569470.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus rhamnosus GG | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1099238..1144427 | 1110646..1111131 | within | 0 |
Gene organization within MGE regions
Location: 1099238..1144427
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRHM_RS05175 (LRHM_1038) | - | 1099238..1100422 (-) | 1185 | WP_014569455.1 | tyrosine-type recombinase/integrase | - |
| LRHM_RS05180 | - | 1100596..1100799 (+) | 204 | WP_016381464.1 | hypothetical protein | - |
| LRHM_RS05185 (LRHM_1039) | - | 1100767..1101768 (-) | 1002 | WP_014569456.1 | DUF6414 family protein | - |
| LRHM_RS05190 (LRHM_1040) | - | 1101879..1102082 (-) | 204 | WP_005716134.1 | hypothetical protein | - |
| LRHM_RS05195 (LRHM_1041) | - | 1102106..1102531 (-) | 426 | WP_015764910.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| LRHM_RS05200 | - | 1102917..1103135 (+) | 219 | WP_016364974.1 | hypothetical protein | - |
| LRHM_RS05205 (LRHM_1042) | - | 1103136..1103891 (-) | 756 | WP_003606998.1 | hypothetical protein | - |
| LRHM_RS05210 (LRHM_1043) | - | 1103998..1104699 (-) | 702 | WP_014569458.1 | DUF3862 domain-containing protein | - |
| LRHM_RS05215 (LRHM_1044) | - | 1104759..1105181 (-) | 423 | WP_014569459.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LRHM_RS05220 (LRHM_1045) | - | 1105171..1105506 (-) | 336 | WP_005714743.1 | helix-turn-helix domain-containing protein | - |
| LRHM_RS05225 (LRHM_1046) | - | 1105644..1105886 (+) | 243 | WP_014569460.1 | helix-turn-helix transcriptional regulator | - |
| LRHM_RS05230 | - | 1105883..1106131 (+) | 249 | WP_029943629.1 | hypothetical protein | - |
| LRHM_RS05235 (LRHM_1047) | - | 1106128..1106355 (-) | 228 | WP_014569461.1 | hypothetical protein | - |
| LRHM_RS15770 (LRHM_1048) | - | 1106443..1106601 (+) | 159 | WP_014569462.1 | hypothetical protein | - |
| LRHM_RS05240 (LRHM_1049) | - | 1106667..1107215 (+) | 549 | WP_014569463.1 | hypothetical protein | - |
| LRHM_RS05245 | - | 1107194..1107424 (+) | 231 | WP_015764912.1 | helix-turn-helix domain-containing protein | - |
| LRHM_RS15945 (LRHM_1051) | - | 1107428..1107556 (+) | 129 | WP_014569465.1 | hypothetical protein | - |
| LRHM_RS05250 (LRHM_1052) | - | 1107568..1107795 (+) | 228 | WP_014569466.1 | hypothetical protein | - |
| LRHM_RS05255 | - | 1107788..1107958 (+) | 171 | WP_015764913.1 | hypothetical protein | - |
| LRHM_RS05260 (LRHM_1053) | - | 1108002..1108877 (+) | 876 | WP_014569467.1 | recombinase RecT | - |
| LRHM_RS05265 (LRHM_1054) | - | 1108897..1109661 (+) | 765 | WP_014569468.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| LRHM_RS05270 (LRHM_1055) | - | 1109677..1110633 (+) | 957 | WP_014569469.1 | DnaD domain-containing protein | - |
| LRHM_RS05275 (LRHM_1056) | ssb | 1110646..1111131 (+) | 486 | WP_014569470.1 | single-stranded DNA-binding protein | Machinery gene |
| LRHM_RS05280 (LRHM_1057) | - | 1111149..1111364 (+) | 216 | WP_014569471.1 | helix-turn-helix domain-containing protein | - |
| LRHM_RS05285 | - | 1111361..1111552 (+) | 192 | WP_015764330.1 | helix-turn-helix domain-containing protein | - |
| LRHM_RS05290 (LRHM_1058) | - | 1111922..1112371 (+) | 450 | WP_014569472.1 | hypothetical protein | - |
| LRHM_RS05295 (LRHM_1059) | - | 1112418..1112672 (+) | 255 | WP_014569473.1 | hypothetical protein | - |
| LRHM_RS05300 (LRHM_1060) | - | 1112669..1113070 (+) | 402 | WP_014569474.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LRHM_RS05305 (LRHM_1061) | - | 1113083..1113547 (+) | 465 | WP_014569475.1 | hypothetical protein | - |
| LRHM_RS05310 (LRHM_1062) | - | 1113559..1113744 (+) | 186 | WP_014569476.1 | hypothetical protein | - |
| LRHM_RS05315 (LRHM_1063) | - | 1113741..1114247 (+) | 507 | WP_014569477.1 | DUF1642 domain-containing protein | - |
| LRHM_RS05320 | - | 1114237..1114416 (+) | 180 | WP_015764915.1 | hypothetical protein | - |
| LRHM_RS05325 | - | 1114403..1114606 (+) | 204 | WP_029943632.1 | hypothetical protein | - |
| LRHM_RS05330 (LRHM_1064) | - | 1114596..1115027 (+) | 432 | WP_014569478.1 | hypothetical protein | - |
| LRHM_RS05335 | - | 1115021..1115386 (+) | 366 | WP_101495024.1 | hypothetical protein | - |
| LRHM_RS05340 (LRHM_1065) | - | 1115383..1115622 (+) | 240 | WP_014569479.1 | hypothetical protein | - |
| LRHM_RS05345 | - | 1115672..1115854 (+) | 183 | WP_029943634.1 | hypothetical protein | - |
| LRHM_RS05350 (LRHM_1066) | - | 1116149..1116577 (+) | 429 | WP_005711378.1 | hypothetical protein | - |
| LRHM_RS05355 (LRHM_1067) | - | 1117605..1118753 (+) | 1149 | WP_014569480.1 | GcrA family cell cycle regulator | - |
| LRHM_RS05360 (LRHM_1068) | - | 1118766..1119308 (+) | 543 | WP_014569481.1 | NUMOD4 domain-containing protein | - |
| LRHM_RS05365 | - | 1119301..1119621 (+) | 321 | WP_015764918.1 | ribonucleoside-diphosphate reductase | - |
| LRHM_RS05370 (LRHM_1070) | - | 1119658..1120191 (+) | 534 | WP_014569483.1 | terminase small subunit | - |
| LRHM_RS05375 (LRHM_1071) | - | 1120169..1121524 (+) | 1356 | WP_029943635.1 | PBSX family phage terminase large subunit | - |
| LRHM_RS05380 (LRHM_1072) | - | 1121529..1122956 (+) | 1428 | WP_014569485.1 | phage portal protein | - |
| LRHM_RS05385 (LRHM_1073) | - | 1122922..1123914 (+) | 993 | WP_014569486.1 | minor capsid protein | - |
| LRHM_RS05390 (LRHM_1074) | - | 1124039..1124695 (+) | 657 | WP_014569487.1 | DUF4355 domain-containing protein | - |
| LRHM_RS05395 (LRHM_1075) | - | 1124711..1125724 (+) | 1014 | WP_014569488.1 | hypothetical protein | - |
| LRHM_RS05400 (LRHM_1076) | - | 1125952..1126326 (+) | 375 | WP_014569489.1 | phage head-tail connector protein | - |
| LRHM_RS05405 (LRHM_1077) | - | 1126331..1126633 (+) | 303 | WP_014569490.1 | hypothetical protein | - |
| LRHM_RS05410 (LRHM_1078) | - | 1126630..1126995 (+) | 366 | WP_015764920.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LRHM_RS05415 (LRHM_1079) | - | 1126996..1127400 (+) | 405 | WP_014569492.1 | DUF3168 domain-containing protein | - |
| LRHM_RS05420 (LRHM_1080) | - | 1127412..1128014 (+) | 603 | WP_014569493.1 | phage tail tube protein | - |
| LRHM_RS05425 (LRHM_1081) | - | 1128101..1128433 (+) | 333 | WP_014569494.1 | tail assembly chaperone | - |
| LRHM_RS05430 (LRHM_1082) | - | 1128538..1128891 (+) | 354 | WP_015764921.1 | hypothetical protein | - |
| LRHM_RS05435 (LRHM_1083) | - | 1128884..1131973 (+) | 3090 | WP_014569496.1 | phage tail protein | - |
| LRHM_RS05440 (LRHM_1084) | - | 1131976..1133964 (+) | 1989 | WP_015764922.1 | distal tail protein Dit | - |
| LRHM_RS05445 (LRHM_1085) | - | 1133964..1136471 (+) | 2508 | WP_014569498.1 | phage tail protein | - |
| LRHM_RS05450 (LRHM_1086) | - | 1136481..1136804 (+) | 324 | WP_005686996.1 | hypothetical protein | - |
| LRHM_RS14705 | - | 1136797..1136928 (+) | 132 | WP_014569499.1 | XkdX family protein | - |
| LRHM_RS05455 (LRHM_1088) | - | 1136958..1137251 (+) | 294 | WP_014569500.1 | hypothetical protein | - |
| LRHM_RS05460 (LRHM_1089) | - | 1137241..1137654 (+) | 414 | WP_014569501.1 | phage holin | - |
| LRHM_RS05465 (LRHM_1090) | - | 1137665..1138963 (+) | 1299 | WP_014569502.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LRHM_RS16050 | - | 1139161..1139235 (+) | 75 | Protein_1053 | glucose-6-phosphate isomerase | - |
| LRHM_RS05470 (LRHM_1092) | - | 1139583..1139870 (-) | 288 | WP_005685833.1 | putative quinol monooxygenase | - |
| LRHM_RS05475 (LRHM_1093) | - | 1140166..1141017 (-) | 852 | WP_005685835.1 | DNA/RNA non-specific endonuclease | - |
| LRHM_RS05480 (LRHM_1094) | - | 1141017..1141760 (-) | 744 | WP_014569504.1 | hypothetical protein | - |
| LRHM_RS05485 (LRHM_1095) | - | 1141889..1143052 (-) | 1164 | WP_005713749.1 | glycosyltransferase | - |
| LRHM_RS05490 (LRHM_1096) | - | 1143510..1144427 (+) | 918 | WP_014569505.1 | Gfo/Idh/MocA family protein | - |
Sequence
Protein
Download Length: 161 a.a. Molecular weight: 17695.37 Da Isoelectric Point: 5.8947
>NTDB_id=47530 LRHM_RS05275 WP_014569470.1 1110646..1111131(+) (ssb) [Lacticaseibacillus rhamnosus GG]
MLNSVSLTGRLTRDVDLRYTQSGTETGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTHKGALVGIEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASAAATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
MLNSVSLTGRLTRDVDLRYTQSGTETGSFTLAVDRKFKSKNGERETDFVNCQIWRKSAENFANFTHKGALVGIEGRIQTR
TYDNAQGQKVFVTEVIVDNFALLESRQASQNNPKSQQTANASAAATTNASQTTPNASRANTTDPFANNGQPIDIQDDDLP
F
Nucleotide
Download Length: 486 bp
>NTDB_id=47530 LRHM_RS05275 WP_014569470.1 1110646..1111131(+) (ssb) [Lacticaseibacillus rhamnosus GG]
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGAGACAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGGGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAATTTCACTCATAAGGGTGCACTTGTTGGCATCGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAGCAGCGACCACGAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTCTGA
TTGCTAAACAGTGTCTCACTAACAGGCCGGCTGACAAGAGATGTTGACTTGCGTTACACGCAAAGTGGCACGGAGACAGG
ATCATTCACGCTGGCCGTTGACCGCAAATTCAAGAGCAAAAACGGAGAACGGGAAACTGATTTCGTAAATTGCCAGATCT
GGCGCAAGTCGGCTGAGAACTTTGCAAATTTCACTCATAAGGGTGCACTTGTTGGCATCGAAGGCCGTATTCAAACGCGT
ACGTACGATAACGCGCAAGGACAGAAAGTGTTCGTGACCGAGGTAATCGTTGATAATTTTGCTTTGCTTGAGTCACGACA
GGCGTCTCAGAACAACCCTAAATCACAGCAAACAGCCAATGCATCAGCAGCAGCGACCACGAACGCGAGTCAAACGACTC
CAAATGCTTCACGAGCGAATACCACGGATCCGTTTGCTAATAATGGCCAGCCGATAGACATCCAAGATGATGATTTGCCA
TTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
61.047 |
100 |
0.652 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.674 |
100 |
0.509 |