Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   I653_RS15155 Genome accession   NC_020832
Coordinates   3032256..3032396 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis str. BAB-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3027256..3037396
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I653_RS15130 (I653_15250) yuxO 3027599..3027979 (-) 381 WP_015483631.1 hotdog fold thioesterase -
  I653_RS15135 (I653_15255) comA 3027997..3028641 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  I653_RS15140 (I653_15260) comP 3028722..3031022 (-) 2301 WP_015483632.1 histidine kinase Regulator
  I653_RS15145 (I653_15265) comX 3031034..3031198 (-) 165 WP_015384519.1 competence pheromone ComX -
  I653_RS15150 (I653_15270) comQ 3031211..3032071 (-) 861 WP_015483633.1 polyprenyl synthetase family protein Regulator
  I653_RS15155 (I653_15275) degQ 3032256..3032396 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  I653_RS21505 - 3032618..3032680 (+) 63 Protein_3039 hypothetical protein -
  I653_RS15160 (I653_15280) - 3032858..3033226 (+) 369 WP_015483634.1 hypothetical protein -
  I653_RS15165 (I653_15285) pdeH 3033202..3034431 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  I653_RS15170 (I653_15290) pncB 3034568..3036040 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  I653_RS15175 (I653_15295) pncA 3036056..3036607 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  I653_RS15180 (I653_15300) yueI 3036704..3037102 (-) 399 WP_015483635.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=47522 I653_RS15155 WP_003220708.1 3032256..3032396(-) (degQ) [Bacillus subtilis subsp. subtilis str. BAB-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=47522 I653_RS15155 WP_003220708.1 3032256..3032396(-) (degQ) [Bacillus subtilis subsp. subtilis str. BAB-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1