Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   I653_RS11755 Genome accession   NC_020832
Coordinates   2372516..2372899 (-) Length   127 a.a.
NCBI ID   WP_015384087.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis str. BAB-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2367516..2377899
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I653_RS11715 (I653_11820) sinI 2368451..2368624 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  I653_RS11720 (I653_11825) sinR 2368658..2368993 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  I653_RS11725 (I653_11830) tasA 2369086..2369871 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  I653_RS11730 (I653_11835) sipW 2369935..2370507 (-) 573 WP_080030740.1 signal peptidase I SipW -
  I653_RS11735 (I653_11840) tapA 2370491..2371252 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  I653_RS11740 (I653_11845) yqzG 2371522..2371848 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  I653_RS11745 (I653_11850) spoIITA 2371890..2372069 (-) 180 WP_003230176.1 YqzE family protein -
  I653_RS11750 (I653_11855) comGG 2372141..2372515 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  I653_RS11755 (I653_11860) comGF 2372516..2372899 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  I653_RS11760 (I653_11865) comGE 2372925..2373272 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene
  I653_RS11765 (I653_11870) comGD 2373256..2373687 (-) 432 WP_015384089.1 comG operon protein ComGD Machinery gene
  I653_RS11770 (I653_11875) comGC 2373677..2373973 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  I653_RS11775 (I653_11880) comGB 2373987..2375024 (-) 1038 WP_015483430.1 comG operon protein ComGB Machinery gene
  I653_RS11780 (I653_11885) comGA 2375011..2376081 (-) 1071 WP_015483431.1 competence protein ComGA Machinery gene
  I653_RS11785 (I653_11890) corA 2376491..2377444 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14293.34 Da        Isoelectric Point: 5.1404

>NTDB_id=47489 I653_RS11755 WP_015384087.1 2372516..2372899(-) (comGF) [Bacillus subtilis subsp. subtilis str. BAB-1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEDGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=47489 I653_RS11755 WP_015384087.1 2372516..2372899(-) (comGF) [Bacillus subtilis subsp. subtilis str. BAB-1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGGATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCACTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment