Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | I653_RS11715 | Genome accession | NC_020832 |
| Coordinates | 2368451..2368624 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis subsp. subtilis str. BAB-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2363451..2373624
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I653_RS11700 (I653_11805) | gcvT | 2364250..2365338 (-) | 1089 | WP_015384081.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| I653_RS11705 (I653_11810) | hepAA | 2365780..2367453 (+) | 1674 | WP_015384082.1 | SNF2-related protein | - |
| I653_RS11710 (I653_11815) | yqhG | 2367474..2368268 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| I653_RS11715 (I653_11820) | sinI | 2368451..2368624 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| I653_RS11720 (I653_11825) | sinR | 2368658..2368993 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| I653_RS11725 (I653_11830) | tasA | 2369086..2369871 (-) | 786 | WP_003230183.1 | biofilm matrix protein TasA | - |
| I653_RS11730 (I653_11835) | sipW | 2369935..2370507 (-) | 573 | WP_080030740.1 | signal peptidase I SipW | - |
| I653_RS11735 (I653_11840) | tapA | 2370491..2371252 (-) | 762 | WP_015384085.1 | amyloid fiber anchoring/assembly protein TapA | - |
| I653_RS11740 (I653_11845) | yqzG | 2371522..2371848 (+) | 327 | WP_015384086.1 | YqzG/YhdC family protein | - |
| I653_RS11745 (I653_11850) | spoIITA | 2371890..2372069 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| I653_RS11750 (I653_11855) | comGG | 2372141..2372515 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| I653_RS11755 (I653_11860) | comGF | 2372516..2372899 (-) | 384 | WP_015384087.1 | ComG operon protein ComGF | Machinery gene |
| I653_RS11760 (I653_11865) | comGE | 2372925..2373272 (-) | 348 | WP_015384088.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=47486 I653_RS11715 WP_003230187.1 2368451..2368624(+) (sinI) [Bacillus subtilis subsp. subtilis str. BAB-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=47486 I653_RS11715 WP_003230187.1 2368451..2368624(+) (sinI) [Bacillus subtilis subsp. subtilis str. BAB-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |