Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   H5405_RS07605 Genome accession   NZ_CP060085
Coordinates   1476127..1476300 (-) Length   57 a.a.
NCBI ID   WP_007612543.1    Uniprot ID   -
Organism   Bacillus velezensis strain HAB-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1471127..1481300
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H5405_RS07555 (H5405_07555) comGD 1471246..1471683 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  H5405_RS07560 (H5405_07560) comGE 1471667..1471981 (+) 315 WP_029326075.1 competence type IV pilus minor pilin ComGE -
  H5405_RS07565 (H5405_07565) comGF 1471926..1472390 (+) 465 WP_228767516.1 competence type IV pilus minor pilin ComGF -
  H5405_RS07570 (H5405_07570) comGG 1472391..1472768 (+) 378 WP_007612567.1 competence type IV pilus minor pilin ComGG Machinery gene
  H5405_RS07575 (H5405_07575) - 1472825..1473004 (+) 180 WP_003153093.1 YqzE family protein -
  H5405_RS07580 (H5405_07580) - 1473045..1473374 (-) 330 WP_007612559.1 DUF3889 domain-containing protein -
  H5405_RS07585 (H5405_07585) tapA 1473633..1474304 (+) 672 WP_029326077.1 amyloid fiber anchoring/assembly protein TapA -
  H5405_RS07590 (H5405_07590) sipW 1474276..1474860 (+) 585 WP_007612550.1 signal peptidase I SipW -
  H5405_RS07595 (H5405_07595) tasA 1474925..1475710 (+) 786 WP_007612547.1 biofilm matrix protein TasA -
  H5405_RS07600 (H5405_07600) sinR 1475758..1476093 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  H5405_RS07605 (H5405_07605) sinI 1476127..1476300 (-) 174 WP_007612543.1 anti-repressor SinI Regulator
  H5405_RS07610 (H5405_07610) - 1476477..1477271 (-) 795 WP_007612541.1 YqhG family protein -
  H5405_RS07615 (H5405_07615) - 1477293..1478963 (-) 1671 WP_029326078.1 DEAD/DEAH box helicase -
  H5405_RS07620 (H5405_07620) gcvT 1479387..1480487 (+) 1101 WP_029326079.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6672.68 Da        Isoelectric Point: 9.8168

>NTDB_id=473798 H5405_RS07605 WP_007612543.1 1476127..1476300(-) (sinI) [Bacillus velezensis strain HAB-2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=473798 H5405_RS07605 WP_007612543.1 1476127..1476300(-) (sinI) [Bacillus velezensis strain HAB-2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719