Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   H5405_RS07550 Genome accession   NZ_CP060085
Coordinates   1470990..1471256 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain HAB-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1465990..1476256
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H5405_RS07530 (H5405_07530) - 1466255..1467556 (-) 1302 WP_007612576.1 hemolysin family protein -
  H5405_RS07535 (H5405_07535) - 1467702..1468652 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  H5405_RS07540 (H5405_07540) comGA 1468849..1469919 (+) 1071 WP_007612574.1 competence type IV pilus ATPase ComGA Machinery gene
  H5405_RS07545 (H5405_07545) comGB 1469906..1470943 (+) 1038 WP_029326074.1 competence type IV pilus assembly protein ComGB Machinery gene
  H5405_RS07550 (H5405_07550) comGC 1470990..1471256 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  H5405_RS07555 (H5405_07555) comGD 1471246..1471683 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  H5405_RS07560 (H5405_07560) comGE 1471667..1471981 (+) 315 WP_029326075.1 competence type IV pilus minor pilin ComGE -
  H5405_RS07565 (H5405_07565) comGF 1471926..1472390 (+) 465 WP_228767516.1 competence type IV pilus minor pilin ComGF -
  H5405_RS07570 (H5405_07570) comGG 1472391..1472768 (+) 378 WP_007612567.1 competence type IV pilus minor pilin ComGG Machinery gene
  H5405_RS07575 (H5405_07575) - 1472825..1473004 (+) 180 WP_003153093.1 YqzE family protein -
  H5405_RS07580 (H5405_07580) - 1473045..1473374 (-) 330 WP_007612559.1 DUF3889 domain-containing protein -
  H5405_RS07585 (H5405_07585) tapA 1473633..1474304 (+) 672 WP_029326077.1 amyloid fiber anchoring/assembly protein TapA -
  H5405_RS07590 (H5405_07590) sipW 1474276..1474860 (+) 585 WP_007612550.1 signal peptidase I SipW -
  H5405_RS07595 (H5405_07595) tasA 1474925..1475710 (+) 786 WP_007612547.1 biofilm matrix protein TasA -
  H5405_RS07600 (H5405_07600) sinR 1475758..1476093 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=473794 H5405_RS07550 WP_042635730.1 1470990..1471256(+) (comGC) [Bacillus velezensis strain HAB-2]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=473794 H5405_RS07550 WP_042635730.1 1470990..1471256(+) (comGC) [Bacillus velezensis strain HAB-2]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATTACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602