Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   H4K32_RS12815 Genome accession   NZ_CP059855
Coordinates   2482239..2482379 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Pm9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2477239..2487379
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H4K32_RS12790 - 2477545..2477943 (+) 399 WP_003152031.1 YueI family protein -
  H4K32_RS12795 - 2478040..2478591 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  H4K32_RS12800 - 2478609..2480075 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  H4K32_RS12805 - 2480205..2481425 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  H4K32_RS12810 - 2481432..2481773 (-) 342 WP_014305721.1 hypothetical protein -
  H4K32_RS12815 degQ 2482239..2482379 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  H4K32_RS12820 - 2482531..2483442 (+) 912 WP_014305720.1 polyprenyl synthetase family protein -
  H4K32_RS12825 comX 2483442..2483606 (+) 165 WP_007613432.1 competence pheromone ComX -
  H4K32_RS12830 comP 2483618..2485909 (+) 2292 WP_015387784.1 histidine kinase Regulator
  H4K32_RS12835 comA 2485990..2486634 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  H4K32_RS12840 - 2486656..2487039 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=472300 H4K32_RS12815 WP_003152043.1 2482239..2482379(+) (degQ) [Bacillus velezensis strain Pm9]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=472300 H4K32_RS12815 WP_003152043.1 2482239..2482379(+) (degQ) [Bacillus velezensis strain Pm9]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891