Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   H3M14_RS05120 Genome accession   NZ_CP059697
Coordinates   1020282..1020581 (+) Length   99 a.a.
NCBI ID   WP_025016383.1    Uniprot ID   A0A9N7P7J9
Organism   Latilactobacillus sakei strain CBA3635     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1015282..1025581
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H3M14_RS05085 (H3M14_05085) - 1015684..1016298 (+) 615 WP_016265380.1 hypothetical protein -
  H3M14_RS05095 (H3M14_05095) - 1016485..1016859 (-) 375 WP_011375004.1 hypothetical protein -
  H3M14_RS05100 (H3M14_05100) - 1016956..1017456 (+) 501 WP_016265379.1 VanZ family protein -
  H3M14_RS05105 (H3M14_05105) - 1017547..1018278 (+) 732 WP_011375002.1 YebC/PmpR family DNA-binding transcriptional regulator -
  H3M14_RS05110 (H3M14_05110) comGA 1018395..1019285 (+) 891 WP_025016380.1 competence type IV pilus ATPase ComGA Machinery gene
  H3M14_RS05115 (H3M14_05115) comGB 1019278..1020285 (+) 1008 WP_061827023.1 type II secretion system F family protein Machinery gene
  H3M14_RS05120 (H3M14_05120) comGC 1020282..1020581 (+) 300 WP_025016383.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  H3M14_RS05125 (H3M14_05125) comGD 1020601..1021005 (+) 405 WP_235596237.1 hypothetical protein Machinery gene
  H3M14_RS05130 (H3M14_05130) comGE 1020992..1021297 (+) 306 WP_016265375.1 hypothetical protein Machinery gene
  H3M14_RS05135 (H3M14_05135) comGF 1021272..1021784 (+) 513 WP_035145013.1 competence type IV pilus minor pilin ComGF Machinery gene
  H3M14_RS05140 (H3M14_05140) - 1021747..1022085 (+) 339 WP_035145011.1 hypothetical protein -
  H3M14_RS05145 (H3M14_05145) - 1022200..1023219 (+) 1020 WP_235596233.1 class I SAM-dependent methyltransferase -
  H3M14_RS05150 (H3M14_05150) - 1023241..1024437 (+) 1197 WP_011374993.1 acetate/propionate family kinase -
  H3M14_RS05155 (H3M14_05155) - 1024492..1024950 (+) 459 WP_035145008.1 hypothetical protein -

Sequence


Protein


Download         Length: 99 a.a.        Molecular weight: 11067.03 Da        Isoelectric Point: 10.1321

>NTDB_id=471396 H3M14_RS05120 WP_025016383.1 1020282..1020581(+) (comGC) [Latilactobacillus sakei strain CBA3635]
MKKKRNAFTLIEMVIVLAIVALLILLISPNLVAQKQRAEKKTDQALVTTLQTQVELAADEQGHQIKSLDELTDKYISKDQ
LKHAKEKGITIDSGTVKQK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=471396 H3M14_RS05120 WP_025016383.1 1020282..1020581(+) (comGC) [Latilactobacillus sakei strain CBA3635]
ATGAAGAAAAAAAGAAATGCTTTTACATTAATCGAAATGGTAATTGTTCTAGCAATTGTGGCGTTGTTAATTTTATTAAT
CTCACCAAATTTGGTGGCTCAAAAACAGCGCGCGGAGAAGAAAACCGATCAAGCTTTAGTGACGACTTTACAAACGCAAG
TTGAATTGGCTGCCGATGAACAAGGTCATCAAATTAAGAGTCTAGATGAATTAACGGATAAGTATATTTCAAAAGACCAA
TTAAAGCACGCAAAGGAGAAGGGGATTACAATTGATAGCGGCACGGTTAAGCAAAAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

89.899

100

0.899