Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HPPN120_RS07855 Genome accession   NC_017378
Coordinates   35539..35652 (+) Length   37 a.a.
NCBI ID   WP_075645715.1    Uniprot ID   -
Organism   Helicobacter pylori Puno120     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 30539..40652
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPPN120_RS00170 (HPPN120_00160) - 30581..32803 (+) 2223 WP_001051547.1 AAA family ATPase -
  HPPN120_RS00175 (HPPN120_00165) panD 32793..33143 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  HPPN120_RS00180 (HPPN120_00170) - 33154..33456 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HPPN120_RS00185 (HPPN120_00175) - 33456..34460 (+) 1005 WP_000468450.1 PDZ domain-containing protein -
  HPPN120_RS00190 (HPPN120_00180) comB6 34468..35523 (+) 1056 WP_000786663.1 P-type conjugative transfer protein TrbL Machinery gene
  HPPN120_RS07855 comB7 35539..35652 (+) 114 WP_075645715.1 comB7 lipoprotein Machinery gene
  HPPN120_RS00195 (HPPN120_00185) comB8 35649..36392 (+) 744 WP_000660499.1 type IV secretion system protein Machinery gene
  HPPN120_RS00200 (HPPN120_00190) comB9 36392..37363 (+) 972 WP_014536837.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPPN120_RS00205 (HPPN120_00195) comB10 37356..38492 (+) 1137 WP_001045862.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPPN120_RS00210 (HPPN120_00200) - 38562..39974 (+) 1413 WP_000694829.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4305.26 Da        Isoelectric Point: 9.3572

>NTDB_id=47055 HPPN120_RS07855 WP_075645715.1 35539..35652(+) (comB7) [Helicobacter pylori Puno120]
MRIFFVIMGLILFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=47055 HPPN120_RS07855 WP_075645715.1 35539..35652(+) (comB7) [Helicobacter pylori Puno120]
ATGAGAATTTTTTTTGTTATTATGGGACTAATATTGTTTGGTTGCACTAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

94.595

100

0.946

Multiple sequence alignment