Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   H2N74_RS15170 Genome accession   NZ_CP059495
Coordinates   3093322..3093462 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JSRB 166     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3088322..3098462
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H2N74_RS15150 (H2N74_15150) - 3088619..3089002 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  H2N74_RS15155 (H2N74_15155) comA 3089024..3089668 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  H2N74_RS15160 (H2N74_15160) comP 3089749..3092052 (-) 2304 WP_021495364.1 histidine kinase Regulator
  H2N74_RS15165 (H2N74_15165) comQ 3092178..3093137 (-) 960 WP_233662477.1 class 1 isoprenoid biosynthesis enzyme Regulator
  H2N74_RS15170 (H2N74_15170) degQ 3093322..3093462 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  H2N74_RS15175 (H2N74_15175) - 3093928..3094269 (+) 342 WP_007613435.1 hypothetical protein -
  H2N74_RS15180 (H2N74_15180) - 3094276..3095499 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  H2N74_RS15185 (H2N74_15185) - 3095629..3097095 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  H2N74_RS15190 (H2N74_15190) - 3097113..3097664 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  H2N74_RS15195 (H2N74_15195) - 3097761..3098159 (-) 399 WP_182071956.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=470159 H2N74_RS15170 WP_003152043.1 3093322..3093462(-) (degQ) [Bacillus velezensis strain JSRB 166]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=470159 H2N74_RS15170 WP_003152043.1 3093322..3093462(-) (degQ) [Bacillus velezensis strain JSRB 166]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891