Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | H2N74_RS15170 | Genome accession | NZ_CP059495 |
| Coordinates | 3093322..3093462 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain JSRB 166 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3088322..3098462
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H2N74_RS15150 (H2N74_15150) | - | 3088619..3089002 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| H2N74_RS15155 (H2N74_15155) | comA | 3089024..3089668 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| H2N74_RS15160 (H2N74_15160) | comP | 3089749..3092052 (-) | 2304 | WP_021495364.1 | histidine kinase | Regulator |
| H2N74_RS15165 (H2N74_15165) | comQ | 3092178..3093137 (-) | 960 | WP_233662477.1 | class 1 isoprenoid biosynthesis enzyme | Regulator |
| H2N74_RS15170 (H2N74_15170) | degQ | 3093322..3093462 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| H2N74_RS15175 (H2N74_15175) | - | 3093928..3094269 (+) | 342 | WP_007613435.1 | hypothetical protein | - |
| H2N74_RS15180 (H2N74_15180) | - | 3094276..3095499 (-) | 1224 | WP_007613436.1 | EAL and HDOD domain-containing protein | - |
| H2N74_RS15185 (H2N74_15185) | - | 3095629..3097095 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| H2N74_RS15190 (H2N74_15190) | - | 3097113..3097664 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| H2N74_RS15195 (H2N74_15195) | - | 3097761..3098159 (-) | 399 | WP_182071956.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=470159 H2N74_RS15170 WP_003152043.1 3093322..3093462(-) (degQ) [Bacillus velezensis strain JSRB 166]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=470159 H2N74_RS15170 WP_003152043.1 3093322..3093462(-) (degQ) [Bacillus velezensis strain JSRB 166]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |