Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   H2N74_RS01945 Genome accession   NZ_CP059495
Coordinates   391481..391600 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain JSRB 166     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 386481..396600
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H2N74_RS01930 (H2N74_01930) - 388094..388777 (+) 684 WP_014416901.1 response regulator transcription factor -
  H2N74_RS01935 (H2N74_01935) - 388764..390191 (+) 1428 WP_100261600.1 HAMP domain-containing sensor histidine kinase -
  H2N74_RS01940 (H2N74_01940) rapC 390349..391497 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  H2N74_RS01945 (H2N74_01945) phrC 391481..391600 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  H2N74_RS01950 (H2N74_01950) - 391751..391861 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  H2N74_RS01955 (H2N74_01955) - 391941..393305 (-) 1365 WP_053285479.1 aspartate kinase -
  H2N74_RS01960 (H2N74_01960) ceuB 393718..394671 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  H2N74_RS01965 (H2N74_01965) - 394661..395608 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  H2N74_RS01970 (H2N74_01970) - 395602..396360 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=470107 H2N74_RS01945 WP_003156334.1 391481..391600(+) (phrC) [Bacillus velezensis strain JSRB 166]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=470107 H2N74_RS01945 WP_003156334.1 391481..391600(+) (phrC) [Bacillus velezensis strain JSRB 166]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718