Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   H1Q60_RS04755 Genome accession   NZ_CP059405
Coordinates   903990..904130 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain MV2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 898990..909130
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1Q60_RS04730 (H1Q60_04730) - 899287..899670 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  H1Q60_RS04735 (H1Q60_04735) comA 899692..900336 (-) 645 WP_129093769.1 response regulator transcription factor Regulator
  H1Q60_RS04740 (H1Q60_04740) comP 900417..902720 (-) 2304 WP_070082286.1 histidine kinase Regulator
  H1Q60_RS04745 (H1Q60_04745) comX 902740..902919 (-) 180 WP_318010531.1 competence pheromone ComX -
  H1Q60_RS04750 (H1Q60_04750) comQ 902873..903859 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  H1Q60_RS04755 (H1Q60_04755) degQ 903990..904130 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  H1Q60_RS04760 (H1Q60_04760) - 904587..904928 (+) 342 WP_181816577.1 hypothetical protein -
  H1Q60_RS04765 (H1Q60_04765) - 904935..906158 (-) 1224 WP_181816578.1 EAL and HDOD domain-containing protein -
  H1Q60_RS04770 (H1Q60_04770) - 906288..907754 (-) 1467 WP_106067969.1 nicotinate phosphoribosyltransferase -
  H1Q60_RS04775 (H1Q60_04775) - 907772..908323 (-) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  H1Q60_RS04780 (H1Q60_04780) - 908420..908818 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=469424 H1Q60_RS04755 WP_003152043.1 903990..904130(-) (degQ) [Bacillus velezensis strain MV2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=469424 H1Q60_RS04755 WP_003152043.1 903990..904130(-) (degQ) [Bacillus velezensis strain MV2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891