Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   H1Q60_RS01590 Genome accession   NZ_CP059405
Coordinates   305301..305678 (-) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus velezensis strain MV2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 300301..310678
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1Q60_RS01550 (H1Q60_01550) - 300798..301592 (+) 795 WP_014305407.1 YqhG family protein -
  H1Q60_RS01555 (H1Q60_01555) sinI 301769..301942 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  H1Q60_RS01560 (H1Q60_01560) sinR 301976..302311 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  H1Q60_RS01565 (H1Q60_01565) - 302359..303144 (-) 786 WP_017418136.1 TasA family protein -
  H1Q60_RS01570 (H1Q60_01570) - 303209..303793 (-) 585 WP_012117977.1 signal peptidase I -
  H1Q60_RS01575 (H1Q60_01575) tapA 303765..304436 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  H1Q60_RS01580 (H1Q60_01580) - 304695..305024 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  H1Q60_RS01585 (H1Q60_01585) - 305065..305244 (-) 180 WP_003153093.1 YqzE family protein -
  H1Q60_RS01590 (H1Q60_01590) comGG 305301..305678 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  H1Q60_RS01595 (H1Q60_01595) comGF 305679..306074 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  H1Q60_RS01600 (H1Q60_01600) comGE 306088..306402 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  H1Q60_RS01605 (H1Q60_01605) comGD 306386..306823 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  H1Q60_RS01610 (H1Q60_01610) comGC 306813..307121 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  H1Q60_RS01615 (H1Q60_01615) comGB 307126..308163 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  H1Q60_RS01620 (H1Q60_01620) comGA 308150..309220 (-) 1071 WP_106067891.1 competence type IV pilus ATPase ComGA Machinery gene
  H1Q60_RS01625 (H1Q60_01625) - 309412..310362 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=469403 H1Q60_RS01590 WP_017418138.1 305301..305678(-) (comGG) [Bacillus velezensis strain MV2]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=469403 H1Q60_RS01590 WP_017418138.1 305301..305678(-) (comGG) [Bacillus velezensis strain MV2]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512