Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   H1Q60_RS01555 Genome accession   NZ_CP059405
Coordinates   301769..301942 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain MV2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 296769..306942
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H1Q60_RS01540 (H1Q60_01540) gcvT 297582..298682 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  H1Q60_RS01545 (H1Q60_01545) - 299106..300776 (+) 1671 WP_017418135.1 SNF2-related protein -
  H1Q60_RS01550 (H1Q60_01550) - 300798..301592 (+) 795 WP_014305407.1 YqhG family protein -
  H1Q60_RS01555 (H1Q60_01555) sinI 301769..301942 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  H1Q60_RS01560 (H1Q60_01560) sinR 301976..302311 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  H1Q60_RS01565 (H1Q60_01565) - 302359..303144 (-) 786 WP_017418136.1 TasA family protein -
  H1Q60_RS01570 (H1Q60_01570) - 303209..303793 (-) 585 WP_012117977.1 signal peptidase I -
  H1Q60_RS01575 (H1Q60_01575) tapA 303765..304436 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  H1Q60_RS01580 (H1Q60_01580) - 304695..305024 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  H1Q60_RS01585 (H1Q60_01585) - 305065..305244 (-) 180 WP_003153093.1 YqzE family protein -
  H1Q60_RS01590 (H1Q60_01590) comGG 305301..305678 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  H1Q60_RS01595 (H1Q60_01595) comGF 305679..306074 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  H1Q60_RS01600 (H1Q60_01600) comGE 306088..306402 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  H1Q60_RS01605 (H1Q60_01605) comGD 306386..306823 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=469401 H1Q60_RS01555 WP_014418369.1 301769..301942(+) (sinI) [Bacillus velezensis strain MV2]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=469401 H1Q60_RS01555 WP_014418369.1 301769..301942(+) (sinI) [Bacillus velezensis strain MV2]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719