Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | H1Q60_RS01555 | Genome accession | NZ_CP059405 |
| Coordinates | 301769..301942 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain MV2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 296769..306942
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1Q60_RS01540 (H1Q60_01540) | gcvT | 297582..298682 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| H1Q60_RS01545 (H1Q60_01545) | - | 299106..300776 (+) | 1671 | WP_017418135.1 | SNF2-related protein | - |
| H1Q60_RS01550 (H1Q60_01550) | - | 300798..301592 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| H1Q60_RS01555 (H1Q60_01555) | sinI | 301769..301942 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| H1Q60_RS01560 (H1Q60_01560) | sinR | 301976..302311 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| H1Q60_RS01565 (H1Q60_01565) | - | 302359..303144 (-) | 786 | WP_017418136.1 | TasA family protein | - |
| H1Q60_RS01570 (H1Q60_01570) | - | 303209..303793 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| H1Q60_RS01575 (H1Q60_01575) | tapA | 303765..304436 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| H1Q60_RS01580 (H1Q60_01580) | - | 304695..305024 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| H1Q60_RS01585 (H1Q60_01585) | - | 305065..305244 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| H1Q60_RS01590 (H1Q60_01590) | comGG | 305301..305678 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| H1Q60_RS01595 (H1Q60_01595) | comGF | 305679..306074 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| H1Q60_RS01600 (H1Q60_01600) | comGE | 306088..306402 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| H1Q60_RS01605 (H1Q60_01605) | comGD | 306386..306823 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=469401 H1Q60_RS01555 WP_014418369.1 301769..301942(+) (sinI) [Bacillus velezensis strain MV2]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=469401 H1Q60_RS01555 WP_014418369.1 301769..301942(+) (sinI) [Bacillus velezensis strain MV2]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |