Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   HU024_RS14695 Genome accession   NZ_CP059344
Coordinates   3009822..3009941 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain K01     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3004822..3014941
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HU024_RS14670 (HU024_14670) - 3005061..3005819 (-) 759 WP_007609404.1 ABC transporter ATP-binding protein -
  HU024_RS14675 (HU024_14675) - 3005813..3006760 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  HU024_RS14680 (HU024_14680) ceuB 3006750..3007703 (-) 954 WP_032872883.1 ABC transporter permease Machinery gene
  HU024_RS14685 (HU024_14685) - 3008117..3009481 (+) 1365 WP_007609394.1 aspartate kinase -
  HU024_RS14690 (HU024_14690) - 3009561..3009671 (+) 111 WP_369878517.1 YjcZ family sporulation protein -
  HU024_RS14695 (HU024_14695) phrC 3009822..3009941 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  HU024_RS14700 (HU024_14700) rapC 3009925..3011073 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  HU024_RS14705 (HU024_14705) - 3011226..3012659 (-) 1434 WP_161503657.1 HAMP domain-containing sensor histidine kinase -
  HU024_RS14710 (HU024_14710) - 3012646..3013329 (-) 684 WP_032872879.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=468892 HU024_RS14695 WP_003156334.1 3009822..3009941(-) (phrC) [Bacillus velezensis strain K01]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=468892 HU024_RS14695 WP_003156334.1 3009822..3009941(-) (phrC) [Bacillus velezensis strain K01]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718