Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HPF30_RS06505 Genome accession   NC_017365
Coordinates   1337657..1337782 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori F30     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1332657..1342782
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPF30_RS06485 (HPF30_1256) - 1333348..1334760 (-) 1413 WP_000694847.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPF30_RS06490 (HPF30_1257) comB10 1334826..1335962 (-) 1137 WP_001045737.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPF30_RS06495 (HPF30_1258) comB9 1335955..1336917 (-) 963 WP_014535278.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPF30_RS06500 (HPF30_1259) comB8 1336917..1337660 (-) 744 WP_000660530.1 type IV secretion system protein Machinery gene
  HPF30_RS06505 comB7 1337657..1337782 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  HPF30_RS06510 (HPF30_1260) comB6 1337798..1338853 (-) 1056 WP_000786706.1 P-type conjugative transfer protein TrbL Machinery gene
  HPF30_RS06515 (HPF30_1261) - 1338861..1339856 (-) 996 WP_000468803.1 PDZ domain-containing protein -
  HPF30_RS06520 (HPF30_1262) - 1339856..1340149 (-) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  HPF30_RS06525 (HPF30_1263) panD 1340160..1340510 (-) 351 WP_000142206.1 aspartate 1-decarboxylase -
  HPF30_RS06530 (HPF30_1264) - 1340500..1342722 (-) 2223 WP_001051535.1 AAA family ATPase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=46859 HPF30_RS06505 WP_001217874.1 1337657..1337782(-) (comB7) [Helicobacter pylori F30]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=46859 HPF30_RS06505 WP_001217874.1 1337657..1337782(-) (comB7) [Helicobacter pylori F30]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878

Multiple sequence alignment