Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HZT45_RS11615 Genome accession   NZ_CP059318
Coordinates   2446052..2446225 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain BIOMA BV10     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2441052..2451225
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HZT45_RS11600 (HZT45_11600) gcvT 2441865..2442965 (-) 1101 WP_015240202.1 glycine cleavage system aminomethyltransferase GcvT -
  HZT45_RS11605 (HZT45_11605) - 2443389..2445059 (+) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  HZT45_RS11610 (HZT45_11610) - 2445081..2445875 (+) 795 WP_052827645.1 YqhG family protein -
  HZT45_RS11615 (HZT45_11615) sinI 2446052..2446225 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HZT45_RS11620 (HZT45_11620) sinR 2446259..2446594 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HZT45_RS11625 (HZT45_11625) tasA 2446642..2447427 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  HZT45_RS11630 (HZT45_11630) sipW 2447492..2448076 (-) 585 WP_012117977.1 signal peptidase I SipW -
  HZT45_RS11635 (HZT45_11635) tapA 2448048..2448719 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  HZT45_RS11640 (HZT45_11640) - 2448978..2449307 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  HZT45_RS11645 (HZT45_11645) - 2449348..2449527 (-) 180 WP_003153093.1 YqzE family protein -
  HZT45_RS11650 (HZT45_11650) comGG 2449584..2449961 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  HZT45_RS11655 (HZT45_11655) comGF 2449962..2450462 (-) 501 WP_257726452.1 competence type IV pilus minor pilin ComGF -
  HZT45_RS11660 (HZT45_11660) comGE 2450371..2450685 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  HZT45_RS11665 (HZT45_11665) comGD 2450669..2451106 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=468525 HZT45_RS11615 WP_003153105.1 2446052..2446225(+) (sinI) [Bacillus velezensis strain BIOMA BV10]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=468525 HZT45_RS11615 WP_003153105.1 2446052..2446225(+) (sinI) [Bacillus velezensis strain BIOMA BV10]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702