Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   JNE32_RS13705 Genome accession   NZ_CP068982
Coordinates   2597542..2597715 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain pb2441     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2592542..2602715
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JNE32_RS13690 (JNE32_13625) gcvT 2593342..2594430 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  JNE32_RS13695 (JNE32_13630) hepAA 2594871..2596544 (+) 1674 WP_029726726.1 SNF2-related protein -
  JNE32_RS13700 (JNE32_13635) yqhG 2596565..2597359 (+) 795 WP_015714249.1 YqhG family protein -
  JNE32_RS13705 (JNE32_13640) sinI 2597542..2597715 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  JNE32_RS13710 (JNE32_13645) sinR 2597749..2598084 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JNE32_RS13715 (JNE32_13650) tasA 2598177..2598962 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  JNE32_RS13720 (JNE32_13655) sipW 2599026..2599598 (-) 573 WP_072692741.1 signal peptidase I SipW -
  JNE32_RS13725 (JNE32_13660) tapA 2599582..2600343 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  JNE32_RS13730 (JNE32_13665) yqzG 2600614..2600940 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  JNE32_RS13735 (JNE32_13670) spoIITA 2600982..2601161 (-) 180 WP_029726723.1 YqzE family protein -
  JNE32_RS13740 (JNE32_13675) comGG 2601233..2601607 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  JNE32_RS13745 (JNE32_13680) comGF 2601608..2601991 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  JNE32_RS13750 (JNE32_13685) comGE 2602017..2602364 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=464025 JNE32_RS13705 WP_003230187.1 2597542..2597715(+) (sinI) [Bacillus subtilis strain pb2441]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=464025 JNE32_RS13705 WP_003230187.1 2597542..2597715(+) (sinI) [Bacillus subtilis strain pb2441]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1