Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   JNE32_RS13745 Genome accession   NZ_CP068982
Coordinates   2601608..2601991 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain pb2441     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2596608..2606991
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JNE32_RS13705 (JNE32_13640) sinI 2597542..2597715 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  JNE32_RS13710 (JNE32_13645) sinR 2597749..2598084 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JNE32_RS13715 (JNE32_13650) tasA 2598177..2598962 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  JNE32_RS13720 (JNE32_13655) sipW 2599026..2599598 (-) 573 WP_072692741.1 signal peptidase I SipW -
  JNE32_RS13725 (JNE32_13660) tapA 2599582..2600343 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  JNE32_RS13730 (JNE32_13665) yqzG 2600614..2600940 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  JNE32_RS13735 (JNE32_13670) spoIITA 2600982..2601161 (-) 180 WP_029726723.1 YqzE family protein -
  JNE32_RS13740 (JNE32_13675) comGG 2601233..2601607 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  JNE32_RS13745 (JNE32_13680) comGF 2601608..2601991 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  JNE32_RS13750 (JNE32_13685) comGE 2602017..2602364 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  JNE32_RS13755 (JNE32_13690) comGD 2602348..2602779 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  JNE32_RS13760 (JNE32_13695) comGC 2602769..2603065 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  JNE32_RS13765 (JNE32_13700) comGB 2603079..2604116 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  JNE32_RS13770 (JNE32_13705) comGA 2604103..2605172 (-) 1070 Protein_2674 competence protein ComGA -
  JNE32_RS13775 (JNE32_13710) - 2605385..2605582 (-) 198 WP_029726717.1 hypothetical protein -
  JNE32_RS13780 (JNE32_13715) corA 2605584..2606537 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=464028 JNE32_RS13745 WP_029726721.1 2601608..2601991(-) (comGF) [Bacillus subtilis strain pb2441]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=464028 JNE32_RS13745 WP_029726721.1 2601608..2601991(-) (comGF) [Bacillus subtilis strain pb2441]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969