Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   HW113_RS09075 Genome accession   NZ_CP058312
Coordinates   1813930..1814373 (-) Length   147 a.a.
NCBI ID   WP_177548807.1    Uniprot ID   -
Organism   Staphylococcus aureus strain BLR-DV     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1783522..1829314 1813930..1814373 within 0


Gene organization within MGE regions


Location: 1783522..1829314
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HW113_RS08860 (HW113_08860) - 1783522..1784277 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  HW113_RS08865 (HW113_08865) - 1784289..1784543 (-) 255 WP_000611512.1 phage holin -
  HW113_RS08870 (HW113_08870) - 1784601..1784996 (-) 396 WP_000398878.1 hypothetical protein -
  HW113_RS08875 (HW113_08875) - 1785002..1786175 (-) 1174 Protein_1714 BppU family phage baseplate upper protein -
  HW113_RS08880 (HW113_08880) - 1786188..1787957 (-) 1770 Protein_1715 glucosaminidase domain-containing protein -
  HW113_RS08885 (HW113_08885) - 1788068..1788688 (-) 621 WP_000355823.1 AP2 domain-containing protein -
  HW113_RS15040 - 1788937..1789044 (-) 108 Protein_1717 hypothetical protein -
  HW113_RS08890 (HW113_08890) - 1789181..1789480 (-) 300 WP_001817316.1 DUF2951 domain-containing protein -
  HW113_RS08895 (HW113_08895) - 1789520..1789693 (-) 174 WP_000782199.1 XkdX family protein -
  HW113_RS08900 (HW113_08900) - 1789697..1790074 (-) 378 WP_112366597.1 DUF2977 domain-containing protein -
  HW113_RS08905 (HW113_08905) - 1790074..1791897 (-) 1824 WP_000634521.1 phage baseplate upper protein -
  HW113_RS08910 (HW113_08910) - 1791897..1793795 (-) 1899 WP_136889223.1 hypothetical protein -
  HW113_RS08915 (HW113_08915) - 1793808..1795694 (-) 1887 WP_015984523.1 SGNH/GDSL hydrolase family protein -
  HW113_RS08920 (HW113_08920) - 1795705..1796646 (-) 942 WP_000560181.1 phage tail domain-containing protein -
  HW113_RS08925 (HW113_08925) - 1796661..1799546 (-) 2886 WP_112366590.1 terminase -
  HW113_RS08930 (HW113_08930) - 1799550..1799699 (-) 150 WP_000617400.1 hypothetical protein -
  HW113_RS08935 (HW113_08935) - 1799879..1800385 (-) 507 WP_000134337.1 tail assembly chaperone -
  HW113_RS08940 (HW113_08940) - 1800451..1801008 (-) 558 WP_000057582.1 tail protein -
  HW113_RS08945 (HW113_08945) - 1801009..1801434 (-) 426 WP_000270190.1 DUF3168 domain-containing protein -
  HW113_RS08950 (HW113_08950) - 1801447..1801854 (-) 408 WP_112366589.1 HK97 gp10 family phage protein -
  HW113_RS08955 (HW113_08955) - 1801841..1802176 (-) 336 WP_000483041.1 phage head closure protein -
  HW113_RS08960 (HW113_08960) - 1802188..1802538 (-) 351 WP_000177351.1 phage head-tail adapter protein -
  HW113_RS08965 (HW113_08965) - 1802544..1802687 (-) 144 WP_000002931.1 hypothetical protein -
  HW113_RS08970 (HW113_08970) - 1802699..1803613 (-) 915 WP_000235168.1 phage major capsid protein -
  HW113_RS08975 (HW113_08975) - 1803630..1804214 (-) 585 WP_001019219.1 DUF4355 domain-containing protein -
  HW113_RS08980 (HW113_08980) - 1804317..1804523 (-) 207 WP_000346033.1 hypothetical protein -
  HW113_RS08985 (HW113_08985) - 1804525..1805478 (-) 954 WP_000184133.1 phage head morphogenesis protein -
  HW113_RS08990 (HW113_08990) - 1805447..1806871 (-) 1425 WP_031872226.1 phage portal protein -
  HW113_RS08995 (HW113_08995) - 1806868..1808091 (-) 1224 WP_029549385.1 PBSX family phage terminase large subunit -
  HW113_RS09000 (HW113_09000) - 1808084..1808578 (-) 495 WP_112366599.1 terminase small subunit -
  HW113_RS09005 (HW113_09005) - 1808931..1809332 (-) 402 WP_000286968.1 hypothetical protein -
  HW113_RS09010 (HW113_09010) rinB 1809333..1809506 (-) 174 WP_002870008.1 transcriptional activator RinB -
  HW113_RS09015 (HW113_09015) - 1809499..1809735 (-) 237 WP_000608279.1 hypothetical protein -
  HW113_RS09020 (HW113_09020) - 1809728..1810015 (-) 288 WP_000195801.1 DUF1381 domain-containing protein -
  HW113_RS09025 (HW113_09025) - 1810052..1810588 (-) 537 WP_000185669.1 dUTP diphosphatase -
  HW113_RS09030 (HW113_09030) - 1810581..1810829 (-) 249 WP_001065026.1 DUF1024 family protein -
  HW113_RS09035 (HW113_09035) - 1810822..1811106 (-) 285 WP_001105618.1 hypothetical protein -
  HW113_RS09040 (HW113_09040) - 1811103..1811507 (-) 405 WP_031925907.1 hypothetical protein -
  HW113_RS09045 (HW113_09045) - 1811510..1811716 (-) 207 WP_000693989.1 hypothetical protein -
  HW113_RS09050 (HW113_09050) - 1811730..1811978 (-) 249 WP_031765532.1 phi PVL orf 51-like protein -
  HW113_RS09055 (HW113_09055) - 1811979..1812356 (-) 378 WP_112366612.1 SA1788 family PVL leukocidin-associated protein -
  HW113_RS09060 (HW113_09060) - 1812369..1812773 (-) 405 WP_000401960.1 RusA family crossover junction endodeoxyribonuclease -
  HW113_RS09065 (HW113_09065) - 1812782..1813000 (-) 219 WP_000338530.1 hypothetical protein -
  HW113_RS09070 (HW113_09070) - 1813007..1813900 (-) 894 WP_000148321.1 DnaD domain-containing protein -
  HW113_RS09075 (HW113_09075) ssbA 1813930..1814373 (-) 444 WP_177548807.1 single-stranded DNA-binding protein Machinery gene
  HW113_RS09080 (HW113_09080) - 1814370..1815020 (-) 651 WP_000840496.1 ERF family protein -
  HW113_RS09085 (HW113_09085) - 1815021..1815557 (-) 537 WP_000999048.1 host-nuclease inhibitor Gam family protein -
  HW113_RS09090 (HW113_09090) - 1815570..1815830 (-) 261 WP_000291489.1 DUF1108 family protein -
  HW113_RS09095 (HW113_09095) - 1815925..1816086 (-) 162 WP_000066026.1 DUF1270 family protein -
  HW113_RS09100 - 1816079..1816216 (-) 138 WP_000230552.1 hypothetical protein -
  HW113_RS09105 (HW113_09100) - 1816266..1816496 (+) 231 WP_000395457.1 hypothetical protein -
  HW113_RS09110 (HW113_09105) - 1816471..1816647 (-) 177 WP_000993178.1 hypothetical protein -
  HW113_RS09115 (HW113_09110) - 1816663..1817415 (-) 753 WP_009560540.1 phage antirepressor KilAC domain-containing protein -
  HW113_RS09120 (HW113_09115) - 1817417..1817602 (-) 186 WP_000933365.1 helix-turn-helix domain-containing protein -
  HW113_RS09125 (HW113_09120) - 1818042..1818251 (+) 210 WP_000772137.1 hypothetical protein -
  HW113_RS09130 (HW113_09125) - 1818244..1818384 (-) 141 WP_000939495.1 hypothetical protein -
  HW113_RS09135 (HW113_09130) - 1818399..1818842 (-) 444 WP_000435360.1 hypothetical protein -
  HW113_RS09140 (HW113_09135) - 1818855..1819619 (-) 765 WP_001002758.1 phage antirepressor Ant -
  HW113_RS09145 (HW113_09140) - 1819619..1819813 (-) 195 WP_000108122.1 helix-turn-helix transcriptional regulator -
  HW113_RS09150 (HW113_09145) - 1820076..1820408 (+) 333 WP_001055143.1 helix-turn-helix domain-containing protein -
  HW113_RS09155 (HW113_09150) - 1820425..1821095 (+) 671 Protein_1771 ImmA/IrrE family metallo-endopeptidase -
  HW113_RS09160 (HW113_09155) - 1821123..1821848 (+) 726 WP_000661437.1 PH domain-containing protein -
  HW113_RS09165 (HW113_09160) - 1821880..1822560 (+) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  HW113_RS09170 (HW113_09165) - 1822767..1824152 (+) 1386 WP_000861313.1 recombinase family protein -
  HW113_RS09175 (HW113_09170) rpmF 1824269..1824442 (-) 174 WP_000290472.1 50S ribosomal protein L32 -
  HW113_RS09180 (HW113_09175) - 1824522..1825079 (-) 558 WP_000872158.1 DUF177 domain-containing protein -
  HW113_RS09185 (HW113_09180) - 1825206..1826345 (+) 1140 WP_000843611.1 nucleotidyltransferase -
  HW113_RS09190 (HW113_09185) coaD 1826407..1826889 (-) 483 WP_000401377.1 pantetheine-phosphate adenylyltransferase -
  HW113_RS09195 (HW113_09190) rsmD 1826891..1827433 (-) 543 WP_001263796.1 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD -
  HW113_RS09200 (HW113_09195) - 1827503..1827892 (+) 390 WP_000814565.1 hypothetical protein -
  HW113_RS09205 (HW113_09200) - 1827895..1828149 (-) 255 WP_001049150.1 YlbG family protein -
  HW113_RS09210 (HW113_09205) - 1828388..1829314 (+) 927 WP_000757569.1 glycerophosphodiester phosphodiesterase -

Sequence

Protein


Download         Length: 147 a.a.        Molecular weight: 16349.94 Da        Isoelectric Point: 5.8347

>NTDB_id=463706 HW113_RS09075 WP_177548807.1 1813930..1814373(-) (ssbA) [Staphylococcus aureus strain BLR-DV]
MNTVNLIGNLVVDPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=463706 HW113_RS09075 WP_177548807.1 1813930..1814373(-) (ssbA) [Staphylococcus aureus strain BLR-DV]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGTAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCGTTTGCGAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(1-100)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

41.279

100

0.483
  ssb Latilactobacillus sakei subsp. sakei 23K

38.235

100

0.442