Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | HW113_RS01815 | Genome accession | NZ_CP058312 |
| Coordinates | 399388..399831 (+) | Length | 147 a.a. |
| NCBI ID | WP_177548807.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BLR-DV | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 391279..427645 | 399388..399831 | within | 0 |
Gene organization within MGE regions
Location: 391279..427645
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HW113_RS14940 | - | 392777..393127 (+) | 351 | WP_223200492.1 | hypothetical protein | - |
| HW113_RS01745 (HW113_01745) | - | 393436..393621 (-) | 186 | WP_000100503.1 | hypothetical protein | - |
| HW113_RS01750 (HW113_01750) | - | 393618..393764 (-) | 147 | WP_001049401.1 | hypothetical protein | - |
| HW113_RS01755 (HW113_01755) | - | 393776..394483 (-) | 708 | WP_000094093.1 | XRE family transcriptional regulator | - |
| HW113_RS01760 (HW113_01760) | - | 394654..394893 (+) | 240 | WP_112366605.1 | helix-turn-helix transcriptional regulator | - |
| HW113_RS01765 (HW113_01765) | - | 394906..395166 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| HW113_RS01770 (HW113_01770) | - | 395190..395729 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| HW113_RS01775 (HW113_01775) | - | 395786..396535 (+) | 750 | WP_001148587.1 | phage antirepressor KilAC domain-containing protein | - |
| HW113_RS01780 (HW113_01780) | - | 396551..396691 (+) | 141 | WP_000939495.1 | hypothetical protein | - |
| HW113_RS01785 (HW113_01785) | - | 396706..397338 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| HW113_RS01790 (HW113_01790) | - | 397397..397660 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| HW113_RS01795 (HW113_01795) | - | 397672..397833 (+) | 162 | WP_000048126.1 | DUF1270 family protein | - |
| HW113_RS01800 (HW113_01800) | - | 397931..398191 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| HW113_RS01805 (HW113_01805) | - | 398204..398740 (+) | 537 | WP_000999048.1 | host-nuclease inhibitor Gam family protein | - |
| HW113_RS01810 (HW113_01810) | - | 398741..399391 (+) | 651 | WP_000840496.1 | ERF family protein | - |
| HW113_RS01815 (HW113_01815) | ssbA | 399388..399831 (+) | 444 | WP_177548807.1 | single-stranded DNA-binding protein | Machinery gene |
| HW113_RS01820 (HW113_01820) | - | 399861..400754 (+) | 894 | WP_000148321.1 | DnaD domain-containing protein | - |
| HW113_RS01825 (HW113_01825) | - | 400761..400979 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| HW113_RS01830 (HW113_01830) | - | 400988..401392 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| HW113_RS01835 (HW113_01835) | - | 401405..401782 (+) | 378 | WP_112366612.1 | SA1788 family PVL leukocidin-associated protein | - |
| HW113_RS01840 (HW113_01840) | - | 401783..402031 (+) | 249 | WP_015980409.1 | phi PVL orf 51-like protein | - |
| HW113_RS01845 (HW113_01845) | - | 402044..402445 (+) | 402 | WP_000695746.1 | hypothetical protein | - |
| HW113_RS01850 (HW113_01850) | - | 402442..402726 (+) | 285 | WP_001105618.1 | hypothetical protein | - |
| HW113_RS01855 (HW113_01855) | - | 402719..402967 (+) | 249 | WP_001065028.1 | DUF1024 family protein | - |
| HW113_RS01860 (HW113_01860) | - | 402960..403469 (+) | 510 | WP_000185649.1 | dUTP diphosphatase | - |
| HW113_RS01865 (HW113_01865) | - | 403506..403742 (+) | 237 | WP_053040393.1 | DUF1381 domain-containing protein | - |
| HW113_RS01870 (HW113_01870) | - | 403767..404003 (+) | 237 | WP_000483477.1 | hypothetical protein | - |
| HW113_RS01875 (HW113_01875) | - | 403996..404382 (+) | 387 | WP_000592213.1 | hypothetical protein | - |
| HW113_RS01880 (HW113_01880) | rinB | 404379..404528 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| HW113_RS01885 (HW113_01885) | - | 404687..405337 (+) | 651 | WP_001005262.1 | hypothetical protein | - |
| HW113_RS01890 (HW113_01890) | - | 405337..405537 (+) | 201 | WP_000265039.1 | DUF1514 family protein | - |
| HW113_RS01895 (HW113_01895) | - | 405565..405981 (+) | 417 | WP_000590126.1 | hypothetical protein | - |
| HW113_RS01900 (HW113_01900) | - | 406213..406512 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| HW113_RS01905 (HW113_01905) | - | 406643..406987 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| HW113_RS01910 (HW113_01910) | - | 406984..408645 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| HW113_RS01915 (HW113_01915) | - | 408661..409848 (+) | 1188 | WP_112366570.1 | phage portal protein | - |
| HW113_RS01920 (HW113_01920) | - | 409832..410569 (+) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| HW113_RS01925 (HW113_01925) | - | 410593..411738 (+) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| HW113_RS01930 (HW113_01930) | - | 411758..412042 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| HW113_RS01935 (HW113_01935) | - | 412032..412316 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| HW113_RS01940 (HW113_01940) | - | 412300..412662 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| HW113_RS01945 (HW113_01945) | - | 412659..413063 (+) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| HW113_RS01950 (HW113_01950) | - | 413060..413467 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| HW113_RS01955 (HW113_01955) | - | 413468..414112 (+) | 645 | WP_000268741.1 | major tail protein | - |
| HW113_RS01960 (HW113_01960) | - | 414166..414378 (+) | 213 | WP_230402383.1 | Ig-like domain-containing protein | - |
| HW113_RS01965 (HW113_01965) | gpG | 414428..414778 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| HW113_RS01970 (HW113_01970) | gpGT | 414829..414966 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| HW113_RS01975 (HW113_01975) | - | 415023..419552 (+) | 4530 | WP_001795393.1 | phage tail tape measure protein | - |
| HW113_RS01980 (HW113_01980) | - | 419549..421033 (+) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| HW113_RS01985 (HW113_01985) | - | 421049..424842 (+) | 3794 | Protein_396 | phage tail spike protein | - |
| HW113_RS01990 (HW113_01990) | - | 424835..424987 (+) | 153 | WP_001000058.1 | hypothetical protein | - |
| HW113_RS01995 (HW113_01995) | - | 425034..425321 (+) | 288 | WP_001040259.1 | hypothetical protein | - |
| HW113_RS02000 (HW113_02000) | - | 425377..425751 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| HW113_RS02005 (HW113_02005) | - | 425877..426179 (+) | 303 | WP_000339141.1 | phage holin | - |
| HW113_RS02010 (HW113_02010) | - | 426191..427645 (+) | 1455 | WP_112366486.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16349.94 Da Isoelectric Point: 5.8347
>NTDB_id=463676 HW113_RS01815 WP_177548807.1 399388..399831(+) (ssbA) [Staphylococcus aureus strain BLR-DV]
MNTVNLIGNLVVDPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
MNTVNLIGNLVVDPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=463676 HW113_RS01815 WP_177548807.1 399388..399831(+) (ssbA) [Staphylococcus aureus strain BLR-DV]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGTAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCGTTTGCGAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAA
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGTAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCGTTTGCGAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
41.279 |
100 |
0.483 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
38.235 |
100 |
0.442 |