Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BSU6051_RS16450 Genome accession   NC_020507
Coordinates   3257072..3257212 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis 6051-HGW     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3252072..3262212
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU6051_RS16425 (BSU6051_31670) yuxO 3252387..3252767 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  BSU6051_RS16430 (BSU6051_31680) comA 3252786..3253430 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSU6051_RS16435 (BSU6051_31690) comP 3253511..3255818 (-) 2308 Protein_3327 two-component system sensor histidine kinase ComP -
  BSU6051_RS16440 (BSU6051_31700) comX 3255833..3256000 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  BSU6051_RS16445 (BSU6051_31710) comQ 3255988..3256887 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  BSU6051_RS16450 (BSU6051_31720) degQ 3257072..3257212 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSU6051_RS22630 - 3257434..3257559 (+) 126 WP_003228793.1 hypothetical protein -
  BSU6051_RS16455 (BSU6051_31730) - 3257673..3258041 (+) 369 WP_003243784.1 hypothetical protein -
  BSU6051_RS16460 (BSU6051_31740) pdeH 3258017..3259246 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BSU6051_RS16465 (BSU6051_31750) pncB 3259383..3260855 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BSU6051_RS16470 (BSU6051_31760) pncA 3260871..3261422 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  BSU6051_RS16475 (BSU6051_31770) yueI 3261519..3261917 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=46277 BSU6051_RS16450 WP_003220708.1 3257072..3257212(-) (degQ) [Bacillus subtilis subsp. subtilis 6051-HGW]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=46277 BSU6051_RS16450 WP_003220708.1 3257072..3257212(-) (degQ) [Bacillus subtilis subsp. subtilis 6051-HGW]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1