Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KSO_RS07695 Genome accession   NC_020272
Coordinates   1495784..1495957 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens IT-45     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1490784..1500957
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KSO_RS07645 (KSO_007865) comGD 1490904..1491341 (+) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  KSO_RS07650 (KSO_007870) comGE 1491325..1491639 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  KSO_RS07655 (KSO_007875) comGF 1491653..1492048 (+) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF Machinery gene
  KSO_RS07660 (KSO_007880) comGG 1492049..1492426 (+) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  KSO_RS07665 (KSO_007885) - 1492483..1492662 (+) 180 WP_003153093.1 YqzE family protein -
  KSO_RS07670 (KSO_007890) - 1492702..1493031 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KSO_RS07675 (KSO_007895) tapA 1493291..1493962 (+) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  KSO_RS07680 (KSO_007900) sipW 1493934..1494518 (+) 585 WP_012117977.1 signal peptidase I SipW -
  KSO_RS07685 (KSO_007905) tasA 1494582..1495367 (+) 786 WP_015388008.1 biofilm matrix protein TasA -
  KSO_RS07690 (KSO_007910) sinR 1495415..1495750 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KSO_RS07695 (KSO_007915) sinI 1495784..1495957 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  KSO_RS07700 (KSO_007920) - 1496134..1496928 (-) 795 WP_014305407.1 YqhG family protein -
  KSO_RS07705 (KSO_007925) - 1496946..1498616 (-) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  KSO_RS07710 (KSO_007930) gcvT 1499039..1500139 (+) 1101 WP_015388009.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=45911 KSO_RS07695 WP_003153105.1 1495784..1495957(-) (sinI) [Bacillus amyloliquefaciens IT-45]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=45911 KSO_RS07695 WP_003153105.1 1495784..1495957(-) (sinI) [Bacillus amyloliquefaciens IT-45]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment