Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | KSO_RS07695 | Genome accession | NC_020272 |
| Coordinates | 1495784..1495957 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens IT-45 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1490784..1500957
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KSO_RS07645 (KSO_007865) | comGD | 1490904..1491341 (+) | 438 | WP_015388002.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| KSO_RS07650 (KSO_007870) | comGE | 1491325..1491639 (+) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| KSO_RS07655 (KSO_007875) | comGF | 1491653..1492048 (+) | 396 | WP_015388004.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| KSO_RS07660 (KSO_007880) | comGG | 1492049..1492426 (+) | 378 | WP_015388005.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KSO_RS07665 (KSO_007885) | - | 1492483..1492662 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| KSO_RS07670 (KSO_007890) | - | 1492702..1493031 (-) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| KSO_RS07675 (KSO_007895) | tapA | 1493291..1493962 (+) | 672 | WP_015388007.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KSO_RS07680 (KSO_007900) | sipW | 1493934..1494518 (+) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| KSO_RS07685 (KSO_007905) | tasA | 1494582..1495367 (+) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| KSO_RS07690 (KSO_007910) | sinR | 1495415..1495750 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KSO_RS07695 (KSO_007915) | sinI | 1495784..1495957 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| KSO_RS07700 (KSO_007920) | - | 1496134..1496928 (-) | 795 | WP_014305407.1 | YqhG family protein | - |
| KSO_RS07705 (KSO_007925) | - | 1496946..1498616 (-) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| KSO_RS07710 (KSO_007930) | gcvT | 1499039..1500139 (+) | 1101 | WP_015388009.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=45911 KSO_RS07695 WP_003153105.1 1495784..1495957(-) (sinI) [Bacillus amyloliquefaciens IT-45]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=45911 KSO_RS07695 WP_003153105.1 1495784..1495957(-) (sinI) [Bacillus amyloliquefaciens IT-45]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |