Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   KSO_RS07655 Genome accession   NC_020272
Coordinates   1491653..1492048 (+) Length   131 a.a.
NCBI ID   WP_015388004.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens IT-45     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1486653..1497048
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KSO_RS07625 (KSO_007845) - 1487365..1488315 (+) 951 WP_014305415.1 magnesium transporter CorA family protein -
  KSO_RS07630 (KSO_007850) comGA 1488507..1489577 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  KSO_RS07635 (KSO_007855) comGB 1489564..1490601 (+) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  KSO_RS07640 (KSO_007860) comGC 1490648..1490914 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  KSO_RS07645 (KSO_007865) comGD 1490904..1491341 (+) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  KSO_RS07650 (KSO_007870) comGE 1491325..1491639 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  KSO_RS07655 (KSO_007875) comGF 1491653..1492048 (+) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF Machinery gene
  KSO_RS07660 (KSO_007880) comGG 1492049..1492426 (+) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  KSO_RS07665 (KSO_007885) - 1492483..1492662 (+) 180 WP_003153093.1 YqzE family protein -
  KSO_RS07670 (KSO_007890) - 1492702..1493031 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KSO_RS07675 (KSO_007895) tapA 1493291..1493962 (+) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  KSO_RS07680 (KSO_007900) sipW 1493934..1494518 (+) 585 WP_012117977.1 signal peptidase I SipW -
  KSO_RS07685 (KSO_007905) tasA 1494582..1495367 (+) 786 WP_015388008.1 biofilm matrix protein TasA -
  KSO_RS07690 (KSO_007910) sinR 1495415..1495750 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KSO_RS07695 (KSO_007915) sinI 1495784..1495957 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  KSO_RS07700 (KSO_007920) - 1496134..1496928 (-) 795 WP_014305407.1 YqhG family protein -

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 14223.53 Da        Isoelectric Point: 9.6547

>NTDB_id=45908 KSO_RS07655 WP_015388004.1 1491653..1492048(+) (comGF) [Bacillus amyloliquefaciens IT-45]
MAVCLFLSGTLGPILHLFLSNRTDNGGLDSREHQIAVQQIMNECKQAETVKPADGGRALACRKTGGEEVRFEIYHKMIRK
RVNGKGHVPILQNAASLTADVKNGLLLLEILSVTGKKNQAVIPVYSSLKGD

Nucleotide


Download         Length: 396 bp        

>NTDB_id=45908 KSO_RS07655 WP_015388004.1 1491653..1492048(+) (comGF) [Bacillus amyloliquefaciens IT-45]
TTGGCAGTCTGTCTTTTCCTATCAGGCACCCTGGGCCCGATTTTACATCTGTTTTTATCAAACCGGACCGATAACGGCGG
ATTAGACAGCCGGGAGCATCAAATTGCCGTTCAGCAGATCATGAACGAATGTAAACAGGCTGAGACTGTGAAGCCGGCCG
ACGGCGGGCGGGCGTTAGCATGCCGGAAAACAGGGGGCGAAGAAGTGCGTTTTGAAATTTATCATAAGATGATAAGGAAA
AGAGTAAACGGAAAAGGCCACGTGCCGATCCTGCAAAACGCGGCATCATTAACGGCTGATGTGAAAAACGGCCTGCTCTT
ATTAGAGATCTTAAGCGTTACAGGTAAAAAGAATCAGGCGGTCATTCCGGTTTACAGCTCTTTAAAAGGTGATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

47.619

96.183

0.458


Multiple sequence alignment