Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BSNT_RS12710 Genome accession   NC_017196
Coordinates   2356309..2356482 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. natto BEST195     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2351309..2361482
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSNT_RS12695 (BSNT_03665) gcvT 2352108..2353196 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  BSNT_RS12700 (BSNT_03666) yqhH 2353638..2355311 (+) 1674 WP_014480248.1 SNF2-related protein -
  BSNT_RS12705 (BSNT_03668) yqhG 2355332..2356126 (+) 795 WP_014480249.1 YqhG family protein -
  BSNT_RS12710 (BSNT_03669) sinI 2356309..2356482 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  BSNT_RS12715 (BSNT_03670) sinR 2356516..2356851 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSNT_RS12720 (BSNT_03671) tasA 2356944..2357729 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  BSNT_RS12725 (BSNT_03672) sipW 2357793..2358365 (-) 573 WP_003230181.1 signal peptidase I -
  BSNT_RS12730 (BSNT_03673) tapA 2358349..2359110 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BSNT_RS12735 (BSNT_03674) yqzG 2359382..2359708 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSNT_RS12740 (BSNT_03676) spoIIT 2359750..2359929 (-) 180 WP_014480252.1 YqzE family protein -
  BSNT_RS12745 (BSNT_03678) comGG 2360000..2360374 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSNT_RS12750 (BSNT_03680) comGF 2360375..2360758 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BSNT_RS12755 (BSNT_03681) comGE 2360784..2361131 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=45491 BSNT_RS12710 WP_003230187.1 2356309..2356482(+) (sinI) [Bacillus subtilis subsp. natto BEST195]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=45491 BSNT_RS12710 WP_003230187.1 2356309..2356482(+) (sinI) [Bacillus subtilis subsp. natto BEST195]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment