Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BSNT_RS12750 Genome accession   NC_017196
Coordinates   2360375..2360758 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. natto BEST195     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2355375..2365758
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSNT_RS12710 (BSNT_03669) sinI 2356309..2356482 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  BSNT_RS12715 (BSNT_03670) sinR 2356516..2356851 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSNT_RS12720 (BSNT_03671) tasA 2356944..2357729 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  BSNT_RS12725 (BSNT_03672) sipW 2357793..2358365 (-) 573 WP_003230181.1 signal peptidase I -
  BSNT_RS12730 (BSNT_03673) tapA 2358349..2359110 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BSNT_RS12735 (BSNT_03674) yqzG 2359382..2359708 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSNT_RS12740 (BSNT_03676) spoIIT 2359750..2359929 (-) 180 WP_014480252.1 YqzE family protein -
  BSNT_RS12745 (BSNT_03678) comGG 2360000..2360374 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSNT_RS12750 (BSNT_03680) comGF 2360375..2360758 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BSNT_RS12755 (BSNT_03681) comGE 2360784..2361131 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  BSNT_RS12760 (BSNT_03682) comGD 2361115..2361546 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  BSNT_RS12765 (BSNT_03683) comGC 2361536..2361832 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BSNT_RS12770 (BSNT_03685) comGB 2361846..2362883 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  BSNT_RS12775 (BSNT_03688) comGA 2362870..2363940 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BSNT_RS12785 (BSNT_03690) - 2364152..2364349 (-) 198 WP_014480259.1 CBS domain-containing protein -
  BSNT_RS12790 (BSNT_03692) corA 2364351..2365304 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=45494 BSNT_RS12750 WP_014480254.1 2360375..2360758(-) (comGF) [Bacillus subtilis subsp. natto BEST195]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=45494 BSNT_RS12750 WP_014480254.1 2360375..2360758(-) (comGF) [Bacillus subtilis subsp. natto BEST195]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment