Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   HUO02_RS11690 Genome accession   NZ_CP054714
Coordinates   2429850..2430227 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain KKLW     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2424850..2435227
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUO02_RS11650 (HUO02_11650) - 2425348..2426142 (+) 795 WP_012117976.1 YqhG family protein -
  HUO02_RS11655 (HUO02_11655) sinI 2426319..2426492 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  HUO02_RS11660 (HUO02_11660) sinR 2426526..2426861 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HUO02_RS11665 (HUO02_11665) tasA 2426909..2427694 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  HUO02_RS11670 (HUO02_11670) sipW 2427759..2428343 (-) 585 WP_012117977.1 signal peptidase I SipW -
  HUO02_RS11675 (HUO02_11675) tapA 2428315..2428986 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  HUO02_RS11680 (HUO02_11680) - 2429245..2429574 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  HUO02_RS11685 (HUO02_11685) - 2429614..2429793 (-) 180 WP_003153093.1 YqzE family protein -
  HUO02_RS11690 (HUO02_11690) comGG 2429850..2430227 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  HUO02_RS11695 (HUO02_11695) comGF 2430228..2430728 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  HUO02_RS11700 (HUO02_11700) comGE 2430637..2430951 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  HUO02_RS11705 (HUO02_11705) comGD 2430935..2431372 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  HUO02_RS11710 (HUO02_11710) comGC 2431362..2431670 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  HUO02_RS11715 (HUO02_11715) comGB 2431675..2432712 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  HUO02_RS11720 (HUO02_11720) comGA 2432699..2433769 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  HUO02_RS11725 (HUO02_11725) - 2433966..2434916 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=454146 HUO02_RS11690 WP_012117980.1 2429850..2430227(-) (comGG) [Bacillus velezensis strain KKLW]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=454146 HUO02_RS11690 WP_012117980.1 2429850..2430227(-) (comGG) [Bacillus velezensis strain KKLW]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512