Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | HUO02_RS11655 | Genome accession | NZ_CP054714 |
| Coordinates | 2426319..2426492 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain KKLW | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2421319..2431492
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUO02_RS11640 (HUO02_11640) | gcvT | 2422132..2423232 (-) | 1101 | WP_012117974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| HUO02_RS11645 (HUO02_11645) | - | 2423656..2425326 (+) | 1671 | WP_012117975.1 | DEAD/DEAH box helicase | - |
| HUO02_RS11650 (HUO02_11650) | - | 2425348..2426142 (+) | 795 | WP_012117976.1 | YqhG family protein | - |
| HUO02_RS11655 (HUO02_11655) | sinI | 2426319..2426492 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| HUO02_RS11660 (HUO02_11660) | sinR | 2426526..2426861 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| HUO02_RS11665 (HUO02_11665) | tasA | 2426909..2427694 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| HUO02_RS11670 (HUO02_11670) | sipW | 2427759..2428343 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| HUO02_RS11675 (HUO02_11675) | tapA | 2428315..2428986 (-) | 672 | WP_012117978.1 | amyloid fiber anchoring/assembly protein TapA | - |
| HUO02_RS11680 (HUO02_11680) | - | 2429245..2429574 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| HUO02_RS11685 (HUO02_11685) | - | 2429614..2429793 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| HUO02_RS11690 (HUO02_11690) | comGG | 2429850..2430227 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| HUO02_RS11695 (HUO02_11695) | comGF | 2430228..2430728 (-) | 501 | WP_012117981.1 | competence type IV pilus minor pilin ComGF | - |
| HUO02_RS11700 (HUO02_11700) | comGE | 2430637..2430951 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| HUO02_RS11705 (HUO02_11705) | comGD | 2430935..2431372 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=454144 HUO02_RS11655 WP_003153105.1 2426319..2426492(+) (sinI) [Bacillus velezensis strain KKLW]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=454144 HUO02_RS11655 WP_003153105.1 2426319..2426492(+) (sinI) [Bacillus velezensis strain KKLW]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |